KEGG   Novosphingobium aromaticivorans: Saro_2894
Entry
Saro_2894         CDS       T00322                                 

Name
(GenBank) methionyl-tRNA formyltransferase
  KO
K00604  methionyl-tRNA formyltransferase [EC:2.1.2.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00670  One carbon pool by folate
nar00970  Aminoacyl-tRNA biosynthesis
nar01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_2894
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Saro_2894
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.2  Hydroxymethyl-, formyl- and related transferases
    2.1.2.9  methionyl-tRNA formyltransferase
     Saro_2894
SSDB
Motif
Pfam: Formyl_trans_N Formyl_trans_C
Other DBs
NCBI-ProteinID: ABD27330
UniProt: Q2G493
Position
complement(3113845..3114750)
AA seq 301 aa
MRIIFMGTPDFAVPTLEALVAAGHDVVAAYSQPPRPAGRGKKLQPSPVHLAAEAHGIDVR
TPVSLKGADEQTTLAAFDADVAVVAAYGLILPQAVLDAPRLGCLNVHGSLLPRWRGAAPV
QRAILAGDEMTGVTIMQMERGLDTGPMLARIETPVDGKTAGDLTAELAVKGAALMVQVLA
DLASYPAVVQPEQGVTYAHKIDKAESRLDFTRDAVDVERQVRAFSPAPGAFFELEGERYR
VLAAEVLGVAGEPGVTVDDVLAIACGTGAIRPTLIQRAGRPAMDTASLLRGRAIPGGTRL
G
NT seq 906 nt   +upstreamnt  +downstreamnt
atgcgcatcatcttcatggggacgcccgatttcgcggtgccgacgctggaggcgctcgtc
gcggccgggcacgatgtggtcgccgcctacagccagccgccgcgtccggcgggacggggc
aagaagctgcaaccctcgcccgtccatctggccgccgaagcccacgggatcgacgtgcgc
acgcccgtctctctcaaaggggcggatgagcagaccacgcttgccgcgttcgatgcggat
gtggcggtcgtcgcggcctatggcctgatcctgccgcaggccgtgctggatgcgccgcgc
ctcggctgcctcaacgtccacggctcgctcctgccgcgttggcgcggcgccgcgccggtc
cagcgcgcgatcctcgcgggcgacgagatgaccggcgtcaccatcatgcagatggagcgg
ggactcgataccgggccgatgctggcgaggatcgaaactccggtcgacggcaagaccgcg
ggcgatctcaccgccgaacttgcggtgaaaggtgccgcgctgatggtgcaggtgctggcc
gacctggcgagctatcctgcggtggtgcagccggagcagggcgtgacctacgcccacaag
atcgacaaggcggagagccggttggacttcacccgcgatgcggtggacgtggaacggcaa
gtccgcgccttttccccggctcccggtgccttcttcgaacttgaaggcgaacgctaccgc
gtgctggcggccgaagtcctcggcgtggcgggcgaaccgggcgtaacggtcgacgacgtg
cttgccattgcctgcggcaccggcgcgatccgaccgaccctgatccagcgcgcgggtcgc
ccggccatggacactgcctcgctgctgcgcgggcgcgccattcccgggggaacgcgtctt
ggttga

DBGET integrated database retrieval system