KEGG   Novosphingobium aromaticivorans: Saro_3206
Entry
Saro_3206         CDS       T00322                                 
Name
(GenBank) methionine synthase (B12-dependent)
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00270  Cysteine and methionine metabolism
nar00450  Selenocompound metabolism
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Saro_3206
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Saro_3206
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_3206
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Saro_3206
SSDB
Motif
Pfam: Met_synt_B12 Pterin_bind B12-binding_2 B12-binding FumaraseC_C
Other DBs
NCBI-ProteinID: ABD27641
UniProt: Q2G3D2
Position
complement(3421708..3424344)
AA seq 878 aa
MTNTPTGSRFVNVGERTNVTGSAAFKKLILAGDYAKAVEVARQQVENGAQVIDVNMDEGL
LDAVEAMTTFLKLIAAEPDIARVPVMIDSSKWEVIEAGLKCVSGKPIVNSISMKEGEDAF
LHHARLCMDYGAAVVVMAFDEKGQADTKERKVEICERAYKLLTGIGFPAEDIIFDPNIFA
VATGIEEHDRYGLDFIEATAEIKARCPHVHISGGLSNLSFSFRGNETVRRAMHSVFLYHA
IPAGMDMAIVNAGQLDIYDQIDPVLREACEDVVLNRAPAAGGDQTATERLIELAESYKGK
DTVAEKAAEEWRGWDVVRRLEHALVKGIDAHVVEDTEEARAAIAARGGRPIEVIEGPLME
GMNTVGDLFGSGKMFLPQVVKSARVMKKAVAHLIPYIEAEKEEGAKAKGRIIMATVKGDV
HDIGKNIVGVVLQCNGYEVIDLGVMVPWATILDTAQKEGVDMIGLSGLITPSLDEMVTVA
EEMQRAGMSIPLLIGGATTSKVHTALRIDPAYDGPVVHVLDASRAVGVASQLLSDTQAQG
FIKATAADYQHVRDARAGKGASKLLSLEDARLNAFSPDFSEKAPPPEQPGRHVFEDWDLT
DLVECFDWTPFFRSWELAGTWPAILDDEIVGESARNLYADARAMLDRIISEKWLTAKGVA
QFWPCARHGDDVILHPNDDETSVRLPFLRQQFIKSRGRANFCLADFIDPAGDWIGGFAVG
IHGIDEHLARFKADNDDYSDILLKALADRFAEAFAERLHQYVRTTLWAYAPGEQLTNEAL
IREQYRGIRPAPGYPACPDHTLKPILFDLLDATNTAGITLTESQAMLPTSAVSGFYFAHP
ESQYFGVATIGRDQLEDYAARRGWDVSAMERWLRPNLD
NT seq 2637 nt   +upstreamnt  +downstreamnt
atgacaaatacccccaccggctcgcgtttcgtcaacgtcggcgaacgcaccaacgtcacc
ggctccgccgcgttcaagaagctgatcctcgcgggcgactacgccaaggcggtcgaagtc
gcgcgccagcaggtcgagaacggcgcgcaggtcatcgacgtcaacatggacgagggcctg
ctcgacgcggtcgaggccatgaccacgttcctcaagctgatcgccgccgagcccgatatt
gcccgcgtgccggtgatgatcgacagctcgaagtgggaagtgatcgaagcgggcctaaag
tgcgtttcgggcaagcccatcgtcaactcgatctcgatgaaggagggcgaggacgccttc
ctccaccacgcccgcctgtgcatggactatggcgctgccgttgtcgtcatggcgttcgac
gagaagggccaggccgatacgaaggagcgcaaggtcgagatctgcgagcgggcctacaag
ttgctcaccggtatcggcttcccggccgaagacatcatcttcgatcccaacatcttcgcc
gtcgccaccggcatcgaggagcatgaccgctacgggctggacttcatcgaagccacggcc
gagatcaaggcgcgctgtccccacgtccatatctcgggcggcctgtcgaacctctcgttc
tcgttccgcggcaacgagacagtgcgccgcgcgatgcattcggtgttcctctaccacgcc
atccctgcgggcatggacatggccattgtcaacgccggccagctcgacatctacgaccag
atcgacccggtcctccgcgaggcttgcgaggacgtcgtgcttaaccgcgcgcctgccgcg
ggtggtgaccagaccgcgaccgaacgcctgatcgaactcgccgaaagctacaagggcaag
gacaccgtcgccgaaaaggccgccgaggaatggcgcggctgggatgtcgtgcgccgcctg
gaacacgcgctcgtcaagggcatcgatgcccacgtcgtcgaagacaccgaagaggcccgc
gccgccatcgccgcgcgcggcggtcgcccgatcgaggtgatcgaaggccccttgatggaa
ggcatgaacacggtcggggacctgttcggctcgggcaagatgttcctgccgcaggtggtc
aagtccgcccgcgtgatgaagaaggccgttgcccaccttatcccctatatcgaggcggaa
aaggaagaaggcgccaaggccaagggccggatcataatggccaccgtcaagggcgacgtt
cacgacatcggcaagaacatcgtcggcgtggtcctgcagtgcaacggctacgaagtgatc
gatctgggtgtcatggtcccctgggcgacgatcctcgacacggcgcagaaggaaggcgtc
gacatgatcggcctgtccggcctcatcacgccctcgctcgacgagatggtgaccgttgcc
gaggaaatgcagcgcgccgggatgagcattccgctgctgatcggcggcgcgaccaccagc
aaggtccacaccgcgctgcgcatcgatcctgcctatgacggacctgtcgtccacgtgctc
gatgccagccgcgcggtcggcgtcgcctcgcaactcctttcggatacgcaggcgcagggc
ttcatcaaggccactgccgccgattaccagcatgtgcgcgatgcgcgcgcgggcaagggc
gcatcaaagctgctgagcctcgaagacgcccggctgaacgccttttcgcccgacttttcg
gaaaaggctccaccgcccgaacagccgggccgccacgtgttcgaagactgggaccttacc
gaccttgtcgagtgcttcgactggaccccgttcttccgctcgtgggaactcgccggcaca
tggccggccatcctcgacgatgaaatcgtcggcgaatccgcgcgcaatctctatgcggat
gcccgcgcgatgctcgacaggatcatcagcgagaaatggcttaccgccaagggcgttgcc
cagttctggccctgcgcgcgccatggcgacgacgtcatcctgcacccgaacgacgacgaa
acatcggtgcgcctgccattcctgcgccagcagttcatcaagagccgtggccgcgcgaac
ttctgccttgccgacttcatcgacccggcgggcgactggatcggcggcttcgcggtcggc
atccacgggatcgacgaacacctcgcccgcttcaaggccgacaacgacgattactcggac
atcctgctgaaggcccttgccgatcgcttcgccgaagccttcgccgagcgcctgcaccag
tacgtccgcaccaccctctgggcctatgctccgggcgagcaactgaccaatgaggcgctg
atccgtgagcagtaccgcggcatccgtcccgcgccgggctatccggcttgccctgaccac
acgctcaagccgatcctgttcgacctgctcgacgcgaccaacacggccggcatcacgctg
accgaatcgcaggccatgctgcccacctcggcggtttcgggattctacttcgcccacccc
gaaagccagtacttcggtgtcgccaccatcggtcgcgatcaactcgaggactacgccgcc
cgccgtggctgggatgtttccgccatggaacgctggcttcgccccaacctagattga

KEGG   Novosphingobium aromaticivorans: Saro_3207
Entry
Saro_3207         CDS       T00322                                 
Name
(GenBank) methionine synthase (B12-dependent)
  KO
K00548  5-methyltetrahydrofolate--homocysteine methyltransferase [EC:2.1.1.13]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00270  Cysteine and methionine metabolism
nar00450  Selenocompound metabolism
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01110  Biosynthesis of secondary metabolites
nar01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Saro_3207
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Saro_3207
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_3207
Enzymes [BR:nar01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.13  methionine synthase
     Saro_3207
SSDB
Motif
Pfam: S-methyl_trans
Other DBs
NCBI-ProteinID: ABD27642
UniProt: Q2G3D1
Position
complement(3424461..3425537)
AA seq 358 aa
MTLIPSPLIPSGARTAFLEQASQRILITDGAFGTEIQNFKLSEEDYAGTLGLAKDQKGNN
DILALTKPEVPESIHRAYFEAGADIAETNTFSANRISQADYAAEHLVREINVESARLARR
VADEFTARDGKPRFVAGAIGPTNKTLSLSPDVNDPGFREIDWDHLVDVYAEQVHALVEGG
ADFILIETVFDTLNAKAGVMSVRQVEKQLGREIPIMMSMTLTDLSGRNLSGHTVEAFWYA
IRHARPLTVGLNCSFGATQLRPHVKALSEIADTLIMVYPNAGLPNELGEYDEMPQTTAGL
VKEWADHGQVNVLGGCCGSTPAHIAAMAQAVKALPPRKMAVPETVTRLAGLEPFIMAA
NT seq 1077 nt   +upstreamnt  +downstreamnt
gtgaccctgatcccttcccccttgattccttcaggcgcccgcaccgcctttcttgaacag
gcgagccagcgcatcctcatcaccgatggcgcgttcggaaccgagatccagaacttcaag
ctctcggaagaagactatgccggtacccttggtcttgcgaaggaccagaagggcaacaac
gacatcctcgcgctgaccaaaccggaagtcccggaatcgattcaccgcgcctatttcgag
gccggggccgacattgccgaaaccaataccttcagcgccaaccgcatcagccaggccgac
tacgccgccgaacatctcgtgcgcgagatcaacgtggaaagcgccaggctcgcccgccgt
gtcgcggatgagttcaccgcccgggacggcaagccgcgcttcgtcgccggcgccatcggc
cccacgaacaagaccctctcgctcagcccggacgtcaacgatccgggattccgcgagatc
gactgggatcaccttgtcgatgtctatgccgaacaggtccacgcccttgtcgaaggcggc
gcggacttcatcctgatcgagacggtctttgacacgctcaacgccaaggcgggtgtcatg
tcggtccgtcaggtcgagaagcagctcggccgtgaaatcccgatcatgatgtcgatgacg
ctgaccgacctttccggccgcaacctctcggggcacacggtagaggcgttctggtacgcg
atccgccacgcaaggcccctgacggtcggcctcaactgttcgttcggtgccacccagttg
cgcccgcacgtcaaggcgctttcagaaatcgccgacaccctgatcatggtctaccccaac
gccggccttcccaacgaactcggcgaatatgacgagatgccacagaccaccgccggcctc
gtcaaggaatgggcggatcacggccaggtcaacgtcctcggcggctgctgcggttcaacg
cccgcgcacatcgccgccatggcgcaggcggtgaaggcgttgcctccgcgcaagatggct
gtgccggaaacggtaacgcggctggcaggtctcgagccgttcatcatggctgcataa

DBGET integrated database retrieval system