KEGG   Novosphingobium aromaticivorans: Saro_3262
Entry
Saro_3262         CDS       T00322                                 

Name
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00670  One carbon pool by folate
nar00790  Folate biosynthesis
nar01100  Metabolic pathways
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Saro_3262
   00670 One carbon pool by folate
    Saro_3262
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Saro_3262
SSDB
Motif
Pfam: DHFR_1
Other DBs
NCBI-ProteinID: ABD27697
UniProt: Q2G376
Position
complement(3483378..3483887)
AA seq 169 aa
MNAARSTPREGLFLIYARADNGVIGRDNALPWRLPADLRRFKALTLGKPMIMGRRTFDSL
PGLLPGRRHVVLTRDSGWAAPGAETATTPEAALALAGPGEIAVIGGAEAYRLFMPLADRV
ELTEVHGDYEGDTTMPPLGTEWEEVMREEYPAQGGHPAHAFVTFRRRAT
NT seq 510 nt   +upstreamnt  +downstreamnt
gtgaacgccgcccgctccacgccgcgcgaggggctgttcctgatctacgcgcgcgccgac
aacggcgtgatcgggcgcgacaacgccctgccatggcgcctcccggccgacctcaggcgg
ttcaaggcgttgacccttggcaagccgatgatcatgggccgcaggaccttcgacagcctg
ccgggccttcttcctggccgccgtcacgttgttcttacccgcgattcgggctgggccgcg
ccgggagcggagaccgcgacaaccccggaggcggccctcgcgctcgccgggcccggagag
atcgcggtaatcggcggggccgaggcctatcgcctgttcatgccgcttgccgatcgcgtg
gaattgaccgaagttcatggcgattacgaaggcgacacgacgatgccgcctcttggaacc
gaatgggaagaggtcatgcgcgaggaatatccggcacagggcggccatcccgcccacgcc
ttcgtgacgttccgccgcagggcgacctag

DBGET integrated database retrieval system