KEGG   Novosphingobium aromaticivorans: Saro_3300
Entry
Saro_3300         CDS       T00322                                 

Name
(GenBank) methenyltetrahydrofolate cyclohydrolase / 5,10-methylenetetrahydrofolate dehydrogenase (NADP+)
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_3300
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Saro_3300
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Saro_3300
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH OCD_Mu_crystall
Other DBs
NCBI-ProteinID: ABD27735
UniProt: Q2G338
Position
3519973..3520866
AA seq 297 aa
MTAAVIDGKAFAATLRGRVGDLATAFEARAGRKAGLAVVLVGEDPASQVYVRSKGKSTLE
AGMASFEHKLPADTAEADLLAVVEQLNADPAVDGILVQLPLPRHMDEQKVIAAINPDKDV
DGFHVINAGRLAVGQPGFVPCTPLGCLMLLKDRLGDLSGLDAVVIGRSNIVGKPMAQLLI
AESCTVTVAHSRTKNLPEVVRRADIVVAAVGRPEMVKGDWIKPGATVIDVGINRVPGKEE
GKTRLVGDVDYASAAEVASAITPVPGGVGPMTIAVLLRNALVAAYRNAGIDLSADAI
NT seq 894 nt   +upstreamnt  +downstreamnt
atgactgctgccgttattgacggaaaggcctttgccgccacgctgcgcgggcgcgtcggc
gaccttgccactgcattcgaggccagggccggtcgcaaggcggggcttgccgtggtgctg
gtgggcgaggacccggcgagccaagtctatgttcgctcgaagggcaagagcacgctcgaa
gcgggcatggcaagcttcgagcacaagcttcccgccgacaccgccgaggccgacctcctt
gccgtagtggagcagctcaacgccgatccggcggttgacggcattctcgtccagcttccc
ctgccccggcacatggacgagcagaaggtcatcgccgcgatcaatcccgacaaggacgtc
gatggcttccacgtgatcaacgcgggccgcctcgccgtcggccagccgggcttcgtgccc
tgcaccccgcttggctgcctgatgttgctaaaggaccgactgggcgacctttccggcctc
gatgccgtggtaatcggccgctcaaacatcgtcggcaagccgatggcgcagttgctcatc
gccgaaagctgcaccgtcacggtcgcgcacagccgcacgaagaacctcccggaagtcgtg
cgccgcgcggacatcgtcgtggcagccgtaggccgccccgagatggtcaagggcgactgg
atcaagccgggcgcaaccgtgatcgacgtcggcatcaaccgcgtcccgggcaaggaagaa
ggcaagacccggctggtcggcgacgtcgactatgcgtccgccgccgaagtcgcgtcggcc
atcaccccggttccgggcggcgtcggcccgatgaccatcgccgtgcttctgcgcaacgcg
ctggtcgcggcctaccgcaacgcggggatcgacctttccgccgacgcgatctga

KEGG   Novosphingobium aromaticivorans: Saro_3791
Entry
Saro_3791         CDS       T00322                                 

Name
(GenBank) Methenyltetrahydrofolate cyclohydrolase
  KO
K01491  methylenetetrahydrofolate dehydrogenase (NADP+) / methenyltetrahydrofolate cyclohydrolase [EC:1.5.1.5 3.5.4.9]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00670  One carbon pool by folate
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01200  Carbon metabolism
nar01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Saro_3791
Enzymes [BR:nar01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.5  methylenetetrahydrofolate dehydrogenase (NADP+)
     Saro_3791
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.9  methenyltetrahydrofolate cyclohydrolase
     Saro_3791
SSDB
Motif
Pfam: THF_DHG_CYH_C THF_DHG_CYH RKP_N
Other DBs
NCBI-ProteinID: ABP64650
UniProt: A4XFD9
Position
pNL2:436808..437674
AA seq 288 aa
MAEIIDGKALATQVLARTAEDVAQMIAAGAGAPGLAVILVGNDPASEVYVGRKIAQCRKA
GIRSIEHRLPADTPQEQVLALIDALNADEEVHGILVQLPLPRHIDAALVLDRIDPGKDVD
GFHPVNVGRLSTGTGGLVPCTPLGVMMLLDSVIDDYRGLKVVVIGKSNIVGKPVSMLLLE
REATVTVTHIETRDLPDVARKADIIVAAAGAPHLVRGYWVKPGAVVIDVGISRVTDHDGV
TRIVGDCATHELDHAKAVTPVPGGVGPMTIACLLSNTVLAAKMRAMKG
NT seq 867 nt   +upstreamnt  +downstreamnt
atggcggaaataatcgacggcaaggcgcttgcgacacaggttcttgcgcgcacggccgag
gacgtggcgcagatgatcgcggcgggcgccggcgcgccgggactggcggtaatccttgtc
ggcaacgacccggcaagcgaggtctatgttggtcgcaagatcgcgcagtgccgcaaggcg
ggcatccgctcgatcgaacatcgactgccggccgataccccgcaggaacaggtactggcg
ctgatcgacgcgctcaacgccgatgaagaggtgcacgggatactggtgcagttgccgctg
ccgcggcacatcgacgcggcgctggtcctcgaccggatcgatccgggcaaggacgtcgac
gggttccatccggtcaacgtcgggcgcctttcgacagggacgggcgggctggtgccctgc
acgccgctgggcgtgatgatgctgctcgacagcgtgatcgacgactatcgcgggctgaag
gtggtggtgatcggcaagtccaacatcgtcggcaagccggtctcgatgctattgctggag
cgcgaggcgacggtcaccgtcacgcatatcgaaacgcgcgacctgcccgacgtggctcgc
aaggcggacatcatcgtcgcggcggcgggcgcgccccatctcgtgcgcggatactgggtg
aagcccggcgcggtggtgatcgatgtgggcatcagccgcgtgacagaccacgacggcgtg
acccgcatcgtcggggactgcgcgacgcacgaactcgatcacgcaaaggcagttaccccg
gtgccgggcggggtagggccgatgaccatcgcctgcctgctcagcaacacggtgctggcc
gcgaagatgcgcgcgatgaagggttag

DBGET integrated database retrieval system