KEGG   Novosphingobium aromaticivorans: Saro_3869
Entry
Saro_3869         CDS       T00322                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
nar  Novosphingobium aromaticivorans
Pathway
nar00626  Naphthalene degradation
nar01100  Metabolic pathways
nar01120  Microbial metabolism in diverse environments
nar01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nar00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    Saro_3869
Enzymes [BR:nar01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     Saro_3869
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: ABP64114
UniProt: A4XDV3
Position
pNL1:35711..36304
AA seq 197 aa
MTRTIDFYFDFISPFSYLAQLKLPEIARAAGCTVDYWPIDIPEAKIAAGNYGPSNREVLP
KIKVMKADLERWAERYGVPLTFPASFACADWNCAVLFAREHGKAEAFVTDAYRRIWGQGI
DPGDRNELAACAIAAGLDPAALIAFVESPAGQNEYRKARSQAIQRGVYGAPLMFVDDQIF
WGNDRLDFLAEYLNNSK
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacccgcacgatcgacttctacttcgatttcatcagcccgttcagctaccttgcgcag
ctcaagctgccggagatcgcgcgggcagcgggatgcacggtcgattactggccgatcgac
attcccgaagccaaaattgccgccggcaactatggcccgtccaatcgcgaggtattgccc
aagatcaaggtcatgaaggcagaccttgagcgctgggccgagcgctatggagtgcccctc
acctttccagccagcttcgcttgcgcagactggaattgcgcggtgctgttcgcccgcgag
cacggtaaggccgaggcatttgtgaccgatgcctaccgccggatctggggccaggggatc
gatcccggcgaccgcaacgaactggccgcatgcgcgatagcagcggggcttgatcccgcg
gcgctgatcgctttcgtcgaatcgcccgccggccagaacgaatatcgcaaggcccggagc
caggcgatccagcgcggcgtgtacggtgcgccgctgatgttcgtcgacgaccagattttc
tggggaaatgaccgattggattttcttgccgagtatttgaacaattcaaaataa

DBGET integrated database retrieval system