KEGG   Nicotiana attenuata: 109214804
Entry
109214804         CDS       T05870                                 

Name
(RefSeq) 5-epi-aristolochene synthase 1
  KO
K15804  5-epiaristolochene synthase [EC:4.2.3.61]
Organism
nau  Nicotiana attenuata
Pathway
nau00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nau00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    109214804
Enzymes [BR:nau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.61  5-epiaristolochene synthase
     109214804
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Flu_C_NS1
Other DBs
NCBI-GeneID: 109214804
NCBI-ProteinID: XP_019234302
UniProt: A0A1J6KYZ4
Position
Unknown
AA seq 548 aa
MASAAVGNYEEEIVRPVANFSPSLWGDHFLSFSIDNQVAEKYAQEIEPLKEQTRSMLLAT
GRKLADTLNLIDTIERLGISYYFEKEIDEILDHIYNQNSNCNDFCTSALQFRLLRQHGFN
ISPQIFSKFQDENGKFRESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIRLESAAP
HLKSPLREQVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNNVLLRFAKLDFNLLQMLH
KQELAEVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIV
DDTFDAYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAEKSH
IVCHAIERMKEVVGHYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSATE
QDFEWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKKAMAKF
QKMAETAWKDINEGLLRPTPVSTEFLTLILNLARIVEVTYIHNLDGYTHPEKVLKPHIIN
LLVDSIKI
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggcctcagcagcagttggcaactatgaagaagagattgttcgccccgtcgccaacttc
tcccctagtctctggggtgatcacttcctttcattctccattgataatcaggttgcggaa
aagtacgctcaagagattgaaccgttgaaggaacagacaaggagtatgttgttagcaaca
ggaagaaaattggctgacacattgaatttgatagacactattgaacgccttggcatatcc
tactactttgagaaagaaattgatgagattttggatcacatttacaaccaaaactcaaac
tgcaatgatttctgcacctctgcacttcaatttcgattgctcaggcaacacggtttcaac
atctctcctcaaattttcagcaaattccaagatgaaaatggcaaattcagggagtctctt
gctagtgatgtcttaggattattaaacttgtatgaagcttcacatgtaaggactcatgct
gacgatatcttagaagacgcacttgctttctccactatccgtcttgaatctgcagctcca
catttgaaatctccacttagggagcaagtgacacatgcccttgagcaatgtttgcacaaa
ggtgttcctagagtcgagactcgattcttcatctcatcaatctatgagaaggaacaatcg
aagaataatgtgttacttcgatttgccaaattggatttcaacttgctccagatgctgcac
aaacaagaacttgctgaagtatcaaggtggtggaaagatttggattttgtaacaacactt
ccatatgctagagatcgagtagttgaatgctacttttgggcattaggagtttattttgag
cctcaatactctcaagctcgcgtcatgctcgttaagaccatatcaatgatttcgattgta
gatgacacctttgatgcttacggtacagttaaagaacttgaggcatacacagatgccata
caaagatgggatatcaacgaaattgatcggcttcctgattacatgaaaatcagttataaa
gctattctagatctttataaggattatgaaaaggaattgtctagtgccgaaaaatctcat
attgtttgccatgcaatagaaagaatgaaagaagtagtaggacattataatgtcgagtca
acatggtttattgaaggatatatgccgcctgtttctgaatacctaagcaatgcactagca
actaccacatattactacctcgcgacaacatcgtatttgggcatgaagtctgccacggag
caagattttgagtggttgtcaaagaatcctaaaattcttgaagctagtgtaattatatgt
cgagttatcgatgacacagccacgtacgaggttgagaaaagcaggggacaaattgcaact
ggaattgagtgctgcatgagagattatggtatatcaacaaaaaaggcaatggctaaattt
caaaaaatggctgagacagcatggaaagatattaatgaaggacttcttaggcccactcct
gtctctacagaatttttaactcttattctcaatcttgctcgtattgttgaggttacatat
atacacaatctagatggatacactcatccggagaaagtcttaaaacctcacattattaac
ctacttgtggactccatcaaaatttga

DBGET integrated database retrieval system