KEGG   Nicotiana attenuata: 109218033
Entry
109218033         CDS       T05870                                 

Name
(RefSeq) 9-divinyl ether synthase
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
nau  Nicotiana attenuata
Brite
KEGG Orthology (KO) [BR:nau00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nau00199]
    109218033
Enzymes [BR:nau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     109218033
Cytochrome P450 [BR:nau00199]
 Cytochrome P450, plant type
  CYP74 family
   109218033
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109218033
NCBI-ProteinID: XP_019237894
UniProt: A0A1J6JWI9
Position
Unknown
AA seq 478 aa
MSSSLVSSNNLPVREIPGDYGFPIISAIKDRYDYFYKQGEDVWFHSKAEKYKSTVVKINM
APGPFTSNDYKLVAFLDASSFVYMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFIDTSD
PNHAALKNYILTSFAKRHNLFIPLFRNSVSDHLFQNLEKQVSDQGKSDFNALLPNMTFGF
IFRLLCDQTNPSDTVLGAQGPEHLRKWLFPQLIPSLSARKLPCFIEDLLFHNFLIPFGLI
KNDYSKLVDAFSKNAGSILDEAERLGIKREEAVHNILFLVGINMFAGLNAFFPHLIRFVG
ESGPTLHARLAKEIRTAIKEEGGAVTLSAINKMSLVKSIVYETLRLRPPVPLQYGKAKKD
FIVQSHDASYMIKKGQFVVGYQPMASRDPKIFDKPDEFVPDRFLGEGEKMLKHVLWSNGR
ETENPAPNNKQCAGKDLVHLLGRLMLVEFFLRYDTFTVEITPLFRAPNVAIKTLTKAT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttcctctttagtatcatcaaataatcttccagtacgtgaaatcccaggtgactat
ggtttccctatcatcagcgccattaaagatcgatacgattacttttacaaacaaggtgaa
gatgtttggtttcatagcaaagctgaaaaatacaaatccactgttgtcaaaatcaacatg
gcaccagggcctttcacctctaatgactacaaattggtggcatttctagatgccagcagc
tttgtctatatgtttgataactctctcattgacaaaactgatactctaggtggtacattc
aagcctggtaaagagtactacggtggttatcgtcctgttgcttttatcgatacttctgac
cctaaccacgctgctctgaaaaactacattcttacttcattcgctaagcgacataactta
ttcattccccttttcagaaactcagtgtctgatcacctctttcaaaatcttgaaaaacag
gtttctgatcaggggaagtcagatttcaatgcacttcttcctaatatgacgtttggtttc
atttttcgcttgctttgtgaccagactaatccgtctgatacagttcttggcgctcaagga
ccagaacatcttcgcaaatggctttttcctcagctcattccatcattgagtgcgagaaaa
cttccttgctttatagaagatttgctcttccataatttcctgataccatttggtctcatt
aaaaatgattacagcaagcttgttgatgcatttagcaagaatgctgggtccatattagat
gaagctgagagacttgggatcaaaagagaggaagctgtacataacatactttttctcgta
ggaattaatatgtttgccggcttgaatgcattcttccctcatctcatcaggtttgtgggc
gaatcggggcctactctacacgctcgacttgctaaagaaatcaggacagctattaaggaa
gaaggaggggcagtcacattatcagcaatcaacaagatgagtttggtcaagtccatagtc
tatgaaacgttgaggcttcgtccaccagtgccattacagtacggtaaagctaaaaaagat
ttcatagtccagagccatgatgcatcttacatgattaagaaagggcagttcgtcgttgga
tatcagcccatggctagtagggatcccaagattttcgacaaacctgatgagtttgttcct
gatagattcttgggtgaaggagagaaaatgctcaaacatgttctttggtctaatggaagg
gaaacagagaatccagcaccaaataataagcaatgtgcaggaaaagacttggtacatcta
ttgggcagactaatgttggtggagtttttcttgagatatgacactttcaccgtggaaatc
actcccctctttcgcgcaccaaatgttgcaatcaagacattaactaaagcaacttga

DBGET integrated database retrieval system