KEGG   Nocardioides sp. JS614: Noca_0612
Entry
Noca_0612         CDS       T00443                                 
Name
(GenBank) xanthine dehydrogenase, molybdenum binding subunit apoprotein
  KO
K19187  6-hydroxypseudooxynicotine dehydrogenase subunit gamma [EC:1.5.99.14]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00760  Nicotinate and nicotinamide metabolism
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
Module
nca_M00810  Nicotine degradation, pyridine pathway, nicotine => 2,6-dihydroxypyridine/succinate semialdehyde
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Noca_0612
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.99  With unknown physiological acceptors
    1.5.99.14  6-hydroxypseudooxynicotine dehydrogenase
     Noca_0612
SSDB
Motif
Pfam: MoCoBD_2 MoCoBD_1 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ABL80146
UniProt: A1SEB1
Position
complement(647541..649913)
AA seq 790 aa
MSRPGASGGLGPSAKRYVGQPVRRREDARLLRGDARFVDDVDIHGQLYMSVVRSSEAHAR
IVSVEPSAARRAPGVRLVITADDIDAEVPLEQIGYHEVYPQIDDYLHPVFAGDRVRYVGQ
PVAAVIADTPYLAEDAAGLVEVTYDLLPPVLDPQYALTDEAEPLFEGQSNEAVRIVKAYG
DVADAFKKAAHVVKGRYVVGRHSGVPMETRGCIAEPDRGRKQLFMWGPVHTHDCQRLIAQ
VLELPLADLRMKHVDIGGNFGVKGGVFPEYIMVGWAAMRLGRPVKWTEDRLEHMVANAHA
REQVHEMAAAFDADGVLLALKDEIWHNHGAFIRQAEPLVSDITVGMVPGPYRVPAYDGLL
HVVVSNKTPLSAYRAPGRYEGTFARERLLDLAAEQIGISQVEIRRRNLLTEADLPFAPGM
DICFEPYHFDSGDVVDHLDKALESAGFDDWEREAAELRAQGRLVGNGIGMLMDKAGLGLY
ETSAIDVDASGRIRVRTGASSVGQGIETVLAQIVADELQVDPELIDVVHGDTELVPEGVG
SWSSRSTVLAGGAARQAALDTLAKAKRLASEMLEANVDDLILVDGRIVVSGLEQQGLSLA
EIAGRWDGWSARLANDEPGLGAQAVYLDEHMNYPYGVTLVQIEIDPATGGHTLRRFLTST
EAGRAINPMTTRGQVIGAAAQGIGGALYEEFLYDESGQPLATSFMDYLLPTSLDVPDVDF
FMTEDAPTPNNPFGAKGLGEVGLIAVGAAIAGAIDDAFGEGVRTIKVPVPPETLWRRSHS
IAFSDEPESM
NT seq 2373 nt   +upstreamnt  +downstreamnt
gtgagtagacctggcgcttccggtggtctcggcccttcagccaagcgatacgtgggacag
cccgtgcgtcgccgtgaggacgcgcggctcctgcggggagatgcgcgtttcgtggacgat
gtcgatattcacgggcagctgtacatgagcgtggtgcgttcatctgaggcccatgcgcgc
atcgtctccgtggagccctctgcggcccgacgggctcccggcgtccggctagtcatcacg
gctgatgacatcgatgctgaagtgccgctggaacagatcggctaccacgaggtttacccg
cagatcgacgactatctgcacccggtcttcgccggtgaccgtgtccggtacgtcgggcaa
cccgtcgccgccgtcatcgctgacacgccgtatctggctgaagacgccgccgggctggtg
gaggtcacctacgacctccttccgccggtgctcgatcctcagtacgccttgaccgatgag
gccgaaccactcttcgaggggcagtccaacgaggccgttcgcatcgtgaaggcgtacggc
gacgtcgcggacgcctttaagaaggcagcgcatgtcgtgaagggtcgctacgtggtcggt
cgtcattccggggtgccgatggagacgagagggtgcatcgcagagcccgaccgcggccgc
aagcaactcttcatgtgggggccggtccacacccacgactgtcagcgcctcatcgcgcaa
gtactcgaactcccgctcgcggatctgcgcatgaaacacgtcgacatcggagggaacttc
ggtgtgaagggcggggtctttccggaatacatcatggtgggctgggcggccatgcgtctg
ggacgtcctgtcaagtggaccgaagatcgcctcgagcacatggtggcaaacgctcacgct
cgcgaacaggtgcacgaaatggccgcggccttcgacgccgacggggtcctgctggctttg
aaggacgagatctggcacaaccacggagcgttcattcggcaggccgagcctctcgtcagc
gacatcacagtcgggatggtcccaggcccctaccgagtgccggcgtacgacgggctcctt
cacgtcgtggtgtccaacaagacgccgctgtccgcctaccgtgctccaggcaggtacgaa
gggaccttcgctcgcgagcggctcctcgacctcgcggccgaacagatcggcatttcgcag
gtagagattcggcgccgcaatctgctgaccgaagccgaccttccattcgcgccgggcatg
gacatctgtttcgagccctaccacttcgattcgggtgacgtcgttgaccacttggacaaa
gcgctcgagtcggcggggttcgacgattgggagcgggaggcggcagagctccgagcgcag
ggccgcttagtcggcaacggaatcggcatgctgatggacaaggctggccttgggctctac
gagacgagcgccatcgacgtagacgcctctggacggatcagagttcgaactggggcatct
tccgtcggacagggtatcgaaacagtcctggcgcagatcgttgccgatgaactccaagtc
gatccagagctcatcgacgtcgttcacggtgacaccgagcttgtgcccgagggtgtcggc
tcctggtcgagtcgctcgaccgttctggccggaggagcggcgcgtcaggcggccctcgac
acgctagccaaggccaagaggctcgccagcgagatgctggaagcaaatgtggacgatctg
atcctcgtcgatggccgcatcgtggtgtccgggctcgagcagcaggggttgagtctcgcc
gagatcgccggacggtgggacggatggtccgcgaggttggccaacgacgagccaggcctc
ggcgcgcaggccgtctacctggatgagcacatgaactatccctacggggtcactctcgtg
cagatcgagattgatcccgccacgggaggtcacaccttgaggcgtttccttaccagcacc
gaggccggacgagcgatcaatccaatgaccacccgcggccaagtgatcggtgcggcagcg
caaggcatcggaggtgccctctacgaggagttcctgtacgacgaatccggtcaaccgttg
gccacgtccttcatggactaccttctgccgacttcgctggacgtgccagatgtcgacttc
ttcatgacggaggacgcgcctacacccaacaacccgttcggggccaagggcttgggggag
gtcggcctcatcgctgtgggcgcggccatcgcgggcgccatagacgatgcctttggcgaa
ggtgtgcgcacgatcaaggtgcccgtcccgcccgagacgctctggcggaggtcgcattcg
atcgcgttcagtgatgaacccgagtcgatgtga

DBGET integrated database retrieval system