KEGG   Nocardioides sp. JS614: Noca_4631
Entry
Noca_4631         CDS       T00443                                 

Name
(GenBank) glycoside hydrolase 15-related protein
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Noca_4631
Enzymes [BR:nca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     Noca_4631
SSDB
Motif
Pfam: Glyco_hydro_15
Other DBs
NCBI-ProteinID: ABL84126
UniProt: A1SQP1
Position
complement(4911500..4912660)
AA seq 386 aa
MSSLHPDPTTLDLSTEERRRFADLATASHRIITGHQDPGGAYPASPGFSAYAGYAWLRDG
AFTAEGISRYGDADSAGRFHDWAARTLARRREQVDGLLAILAEGRSPARVAMLPTRFTFA
GEDGTDDWWDFQTDGYGTWLWAVVAFARRHGQGLDRWRSGVEVAVDYLTGFWSSPCYDWW
EEHAEHRHVSTLAAIHGGLRSVLGADALDPARADAAASAIAEIRELVRRRGVADGHLTKW
LGTDAVDASLASAVVPFGLVSDHDPLAAGTLRAVAEQLDNGGGVHRFRDDVFYGGGQWLL
LSALLGWNLAERGETDAALRYLRWVAGQATAAGELPEQVSGHLLHPGHRQEWIDRWGPVA
TPLLWSHGMYLILADTLGLLREEGDR
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgtcctccctgcaccccgacccgaccacgctcgacctgagtaccgaggagcgccgccga
ttcgccgacctcgcgacggcgagccaccggatcatcaccggccaccaggaccccggtggc
gcctaccccgccagcccgggcttctcggcgtacgccggctacgcctggctgcgcgacggc
gcgttcactgccgagggcatctcccggtacggcgacgccgactcggccggccggttccac
gactgggccgcgcgcaccctggcgcggcggcgcgagcaggtggacggcctcctggcgatc
ctggctgagggccggagcccggcgcgcgtggcgatgctgcccacgcggttcacgttcgcc
ggcgaagacggaaccgacgactggtgggacttccagaccgacggctacggcacctggctg
tgggcggtggtcgcgttcgcccgccggcacggccagggcctggaccggtggcgcagcggc
gtcgaggtcgccgtcgactacctgaccggcttctggtcctcaccgtgttacgactggtgg
gaggagcacgccgagcaccggcatgtctcgaccctcgccgccatccacggcggcctccgg
tcggttctcggggccgatgcgttggaccctgcgcgggccgacgccgcggcgtccgcgatc
gccgagatccgcgagctggtccgccggcggggtgttgcggacggccatctcaccaagtgg
ctgggaaccgacgcggtcgatgcctcgctggcgtccgcggtcgtgccgttcggtctggtc
tccgaccacgacccgctcgcggccggaacgcttcgggcggtcgctgaacagctcgacaac
ggtggcggggtccaccggttccgcgacgacgtcttctacggcggtggccagtggctgctc
ctctcggccctgctcggctggaacctcgccgagcgcggcgagaccgatgccgcgctccgc
tacctgcgctgggtcgccggccaggcaaccgcggccggcgagctccccgagcaggtgtcc
ggccacctcctgcaccccgggcaccgtcaggagtggatcgaccgctgggggccggtagcg
accccgctgctgtggtcgcacggcatgtacctgatcctcgccgacaccctcggcctgctg
cgcgaggagggcgaccggtga

DBGET integrated database retrieval system