KEGG   Nocardioides sp. JS614: Noca_4806
Entry
Noca_4806         CDS       T00443                                 

Name
(GenBank) oxidoreductase FAD/NAD(P)-binding domain protein
  KO
K22356  alkene monooxygenase reductase
Organism
nca  Nocardioides sp. JS614
Pathway
nca00625  Chloroalkane and chloroalkene degradation
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Noca_4806
SSDB
Motif
Pfam: NAD_binding_1 FAD_binding_6 Fer2 NAD_binding_6 Fer2_4
Other DBs
NCBI-ProteinID: ABL79390
UniProt: A1SC55
Position
pNOCA01:complement(130121..131161)
AA seq 346 aa
MENKVTILPFDETLDVEPEESILQAVLRQGRYVKYGCKHGGCSTCRAEVVDGDYRLGDST
SFALSDADRNAGVVLLCSTFAESGHLVVDVSETMDDLTEEQYQAGQHIQEFAATVDRIDA
LTHDIRWLGLRLNEPETMPFVAGQYVEVGVPGMPDQWRSFSMANSPTESDRVDLIVKVLP
GGCFSSVLDQRLSLGDQVQLRGPLGQFGVQLSHRPMIMIAGGSGMAPILGILRELVATGN
RREVTFFYGARTAGDLFLVEELGQLARQHDWFTFIPALSDAGADGAAWEGETGLITEVLA
RHLPSTVGREAYLCGPPPMIDAAVEVLESSGCKPRHIHFDRFVPSG
NT seq 1041 nt   +upstreamnt  +downstreamnt
atggaaaataaagtcacaatcttgccgttcgacgagactctcgacgtcgaacccgaggag
tcgatcctccaagccgtcctcagacagggccgatacgtcaagtacgggtgtaagcacggc
ggatgcagcacctgtcgcgcagaggtcgtggacggcgactaccgactcggcgatagcacc
tcgttcgctctgagtgacgcggaccggaacgccggagtggtgctgctttgctcgaccttc
gccgaatccggtcatctggtcgtggacgtctccgagacgatggacgacctcaccgaagag
cagtaccaggccggtcagcacatccaggaatttgccgccaccgttgatcggatcgatgcg
ctcacccatgacatccgctggctcggacttcggctcaacgagcctgaaacgatgcccttt
gtcgctgggcaatacgtcgaggtcggcgtccccggaatgccagaccaatggcgctccttc
tcgatggccaactcgcccactgagagcgaccgtgtggacctcattgtcaaggtgctgccc
ggtggctgtttctcctcggtactggaccagcggctctcactcggagaccaggtccagctt
cgcggcccgctcggacagttcggcgtccagctgtcccaccgtccgatgatcatgatcgca
ggtggatccggcatggctccgatcctggggatcctgcgggagctcgtggccacgggaaac
cgtcgcgaagtcacgttcttctacggcgcacgtaccgcgggcgatctcttcctcgtcgag
gaactggggcagctcgctcgccagcatgactggttcacgttcatccccgctctgagtgat
gcgggtgccgacggtgcggcatgggagggcgagacggggctgatcaccgaggtgcttgcg
cgacaccttccctcaacggttggtcgcgaggcctacctttgcggcccccctcccatgatc
gatgccgccgtggaggttctggaatcgagtggctgcaagccgcgccatatccacttcgat
cggttcgtgccctccggctga

DBGET integrated database retrieval system