KEGG   Nocardioides sp. JS614: Noca_4808
Entry
Noca_4808         CDS       T00443                                 

Name
(GenBank) monooxygenase component MmoB/DmpM
  KO
K22355  alkene monooxygenase coupling protein
Organism
nca  Nocardioides sp. JS614
Pathway
nca00625  Chloroalkane and chloroalkene degradation
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Noca_4808
SSDB
Motif
Pfam: MmoB_DmpM
Other DBs
NCBI-ProteinID: ABL79392
UniProt: Q5U9L0
Position
pNOCA01:complement(132773..133090)
AA seq 105 aa
MSTRDFTKVRDTVGISLIGSAETAETVAMVEEEIPDAKITDNDCFYKIEREGLLRFDMEN
LSERLGRPYSVHDFLVNMTSYYGRIVVNDGVIEIHTEILPDRFRD
NT seq 318 nt   +upstreamnt  +downstreamnt
atgtcaacaagagacttcaccaaggtccgggacacggtcggcatttcccttatcggcagc
gccgagaccgcggagacagtggccatggtcgaggaggagattcccgacgcgaagatcact
gacaacgactgcttctacaagatcgagcgcgagggtctgctccggttcgacatggagaac
ctgtccgagcggctaggccgtccttactcggttcacgactttctggtgaacatgacgtcc
tactacggccgcatcgtcgtcaacgacggcgtcatcgagattcacaccgagatcctcccc
gatcgattccgcgactag

DBGET integrated database retrieval system