KEGG   Nocardioides sp. JS614: Noca_4809
Entry
Noca_4809         CDS       T00443                                 

Name
(GenBank) Methane monooxygenase
  KO
K22354  alkene monooxygenase beta subunit [EC:1.14.13.69]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00625  Chloroalkane and chloroalkene degradation
nca01100  Metabolic pathways
nca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Noca_4809
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.69  alkene monooxygenase
     Noca_4809
SSDB
Motif
Pfam: Phenol_Hydrox
Other DBs
NCBI-ProteinID: ABL79393
UniProt: A1SC58
Position
pNOCA01:complement(133105..134154)
AA seq 349 aa
MAVYTAPKRTNLSGNRNFTWFTPAGKRPTEYEDLTVGQQSTPAQYAFQGWPVRFDDGRDP
YTEDTTVIRSSDWYTFRDPNETMNRGYITGVNESENAIQRSFASAHTAGLFAYADEGWVR
TGLAEHYMTYPFVEYGLFLALCYAEREALSDTATFPIVFEAADKLRHLQGVVYYSFELEK
AFPWFDDSGFMEAWLNEPIWQGARKAVENIIALNDWMEIVVAINVCFDQLFGGLAKIEYF
SRFAAANGDMVTPILIASAESDSARTENWTTALLEHVLDDSVHGGHNRSVITSWVEKWNA
YALEACNAFAPVFDQATTKAATYPAALEDVMRKQSTYLEGLGLSVPGAA
NT seq 1050 nt   +upstreamnt  +downstreamnt
atggctgtctacaccgcaccgaagcgaaccaatctctcgggtaaccgcaacttcacctgg
ttcacgcccgcaggcaagagacccaccgagtacgaggacttgaccgtcggtcagcagtcc
acccccgcccaatacgcgttccagggctggccggtccggttcgacgacggtcgagacccg
tacaccgaagacacgacagtcattcggtcctcggactggtacacgttccgggacccgaac
gagacaatgaaccggggctacatcacgggagttaacgagtcagaaaacgcgattcagcga
tctttcgccagcgcgcacaccgccggactctttgcctacgccgacgaaggctgggtccgg
acggggctggccgagcactacatgacctatccctttgtcgagtacggattgttcctggcg
ctctgttatgccgagcgagaggccctgtcggatacggcgacctttccgatcgtcttcgag
gccgcggacaagttgcggcacctccaaggagtcgtctactactccttcgagctggagaag
gcgttcccctggttcgacgactccggcttcatggaggcctggctgaatgagccgatctgg
cagggcgcccgcaaggccgttgagaacatcattgcgctcaacgactggatggagatcgta
gtagcgatcaacgtctgcttcgaccagctgttcggtggccttgccaagatcgagtacttc
agccgcttcgcagcagcgaatggcgacatggtgactccaatcctgatcgcctctgcggag
tccgacagtgcccgcaccgagaactggacgaccgcacttctcgagcacgtgttggacgac
tcggtccacggcggccacaaccgaagcgtcatcacctcctgggtggagaagtggaacgcc
tacgccctcgaggcatgcaacgcgttcgcccccgtgttcgaccaagccacgacgaaggca
gcgacatacccagcggccttggaagacgtgatgaggaagcagtccacctacctcgagggg
ctcggcctgtccgtccccggcgcggcctga

DBGET integrated database retrieval system