KEGG   Nocardioides sp. JS614: Noca_4810
Entry
Noca_4810         CDS       T00443                                 

Name
(GenBank) methionine synthase (B12-independent)
  KO
K22363  2-hydroxypropyl-CoM lyase [EC:4.4.1.23]
Organism
nca  Nocardioides sp. JS614
Pathway
nca00625  Chloroalkane and chloroalkene degradation
nca01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nca00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Noca_4810
Enzymes [BR:nca01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.23  2-hydroxypropyl-CoM lyase
     Noca_4810
SSDB
Motif
Pfam: Meth_synt_2 Meth_synt_1 TmoB ribosomal_L24
Other DBs
NCBI-ProteinID: ABL79394
UniProt: Q5U9J8
Position
pNOCA01:complement(134268..135380)
AA seq 370 aa
MRIGSQDVLLPTTMVGNYPNPRWYDGSGFATFPKGEFVYDAISREAFEDAVGAIVHDQEA
AGLDIISDGKVYGGDSPYGQILYHYTERMTGYKNSGPPIGLPIYSTLYAPTCVGEVRREA
PLHLANLRATRKATKKPVKISYVGIQVLAAATNNQFYKETKELGMAIAKAFNEDFKELAD
NGCDIIQIDEFVWPYGMGDWEIEVLNAAVEGVSSQIWVHTCWGNYSGTPGYFPDDEDTEF
GAWVLDHRPTDAPAPQAAVPIFPEVLGANIDALNYEVGRTGPDDLKLLVDNNWEKDFVAG
IIDVKSTVTETADEVADRIRAVLEFVPAERLGLSTDCGLINLPRMISAGKLRALADGAAI
VRKELTAQQA
NT seq 1113 nt   +upstreamnt  +downstreamnt
atgcgaatcggctctcaagatgtgcttctgccaaccaccatggtcggcaactaccccaac
ccccgctggtacgacggcagcgggttcgcgacgttccccaagggcgagttcgtctacgac
gcgatcagccgagaggcattcgaggacgccgtcggcgccatcgtccatgaccaggaggcc
gccggcctcgacatcatcagcgacggcaaggtgtacggcggggactcgccgtacggtcag
atcctctaccactacaccgagcggatgaccggctacaagaactccggcccgccgatcggc
ctgccgatctactccacgctgtacgcgcccacgtgcgtcggtgaggtgcgccgcgaagcc
ccgctccacctggccaacctgcgcgccacccgcaaggcaaccaagaagcccgtgaagatc
tcctatgtgggcatccaggtgctggccgcggcgaccaacaaccagttctacaaggagacc
aaggaactgggcatggctatcgccaaggccttcaacgaggacttcaaggagctcgctgac
aacggctgcgacatcattcagatcgacgagttcgtctggccctacggcatgggcgattgg
gagatcgaggtgctgaacgctgcggtcgaaggcgtcagctcccagatctgggtgcacacc
tgctggggcaactactccggcacacccggctacttccccgacgacgaggacaccgagttc
ggcgcatgggttctcgaccaccgcccgaccgatgcgccggctccccaggcggccgttccg
atcttccccgaagtcctcggcgccaacatcgacgccctgaactacgaggtcggacgcacc
ggcccggacgacctcaagctcctggttgacaacaactgggagaaggacttcgtcgccggc
atcatcgacgtcaagagcaccgtgaccgaaaccgctgacgaggtcgccgaccggatccgc
gcggttctcgagttcgtgcccgccgagcgtctcggactcagtaccgactgcggcctcatc
aacctgccccgcatgatctccgccggcaagctgcgcgccctcgccgacggcgccgccatc
gtccgcaaggaactcaccgcgcagcaggcctga

DBGET integrated database retrieval system