KEGG   Nocardioides sp. JS614: Noca_4827
Entry
Noca_4827         CDS       T00443                                 

Name
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K22364  2-oxopropyl-CoM reductase (carboxylating) [EC:1.8.1.5]
Organism
nca  Nocardioides sp. JS614
Brite
KEGG Orthology (KO) [BR:nca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Noca_4827
Enzymes [BR:nca01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.5  2-oxopropyl-CoM reductase (carboxylating)
     Noca_4827
SSDB
Motif
Pfam: Pyr_redox_2 Pyr_redox_dim Pyr_redox_3 Pyr_redox FAD_binding_2 K_oxygenase DAO HI0933_like NAD_binding_7
Other DBs
NCBI-ProteinID: ABL79411
UniProt: A1SC76
Position
pNOCA01:complement(155578..157197)
AA seq 539 aa
MVARSLTLAATRANDEERPMDLRNSVLSMAEWEDLIHRAETGEVNEPLENVDHDDTRPYD
AIFIGGGAGGRFGSAYLQARGGRQLVIDKWPFLGGSCPHQACVPHHLFSEAAREMDYMRW
NAGTLWFPEFDDKRASIRDLVDLFKAGRNNPHAFMNWQSKEQLGMEYILNAEATVIDANT
VEVSGRRYTTRNIVLATGARSYVPDGIPGLELHGVFDFASLIEELDYEPSRCVIIGGSKI
ALEYGSFYQAAGCQTTIVSRSPLMRTASLHHVDEDLRTYVVGNMRKRGMEILEGAEPIEV
IGNGKVTGVRVRLADGSEKTIDTDFVFMGTGERPHTKPFVDALGIEVDEKGFVQVDSRMR
TSVPGVYAIGDLIGSPMEMFKARKCGMTAARNIMGDPYEFDFSEYPDFLHTTYEVTWVGL
SEEEARAEYGDIAVIQMPPKGIRDDELALPCAEGSMLYAFTRPELTGFQKAVYDGKTRRL
LGAHHVGFGAKDAFQYLDHLIRKGITVDEMGEMNELFLNPDHFIQLSRLRAGQQHLTDL
NT seq 1620 nt   +upstreamnt  +downstreamnt
gtggtcgctcgctccctgacgctggcggccacacgggccaacgacgaggagagaccgatg
gacctgcgcaacagcgtgctgagcatggccgagtgggaagacctgatccaccgtgccgaa
accggagaggtgaatgagccgctcgagaacgtcgaccacgacgacacgcgtccctacgac
gcgatcttcatcggcggcggggccggcgggcgcttcgggtccgcgtacctgcaggcgcgt
ggcggccggcagttggtgatcgacaagtggcctttccttggcggctcgtgcccgcaccag
gcctgcgtgccgcaccacctgttctccgaggccgcccgcgagatggactacatgcgttgg
aacgccgggacgctctggttccccgagttcgacgacaagcgtgcctccatccgggacctg
gtcgacctgttcaaagccggacgaaacaatccgcacgcgttcatgaactggcagagcaag
gagcagctggggatggagtacatcctcaatgccgaggccaccgtcatcgacgcgaacact
gtggaggtgtcggggaggcgttacacgactcgcaacatcgtcctcgcgaccggcgcgcgc
agctacgtgcctgacggcatccccggcctcgagctgcacggggtgttcgacttcgccagt
ctcatcgaggagctcgactacgagccgtcccgctgcgtgatcatcggtggctccaagatt
gccctggagtacggctccttctaccaggctgctggttgccagacgacgatcgtgtcccgc
agcccgctgatgcgtacggcgagcctgcaccacgtcgacgaggatctgcgcacgtacgtc
gtgggcaacatgcgcaagcgggggatggagatcctcgagggagccgagccgatcgaggtg
atcggcaacggcaaggtgaccggtgtccgcgtgcggctggccgacggcagcgagaagacg
atcgacaccgacttcgtcttcatgggcaccggggagcggccgcacacgaagccgttcgtc
gatgcgctgggtatcgaggtggatgagaaggggttcgttcaggtcgactcgcgcatgcgg
acctcggtgccgggcgtctacgcgatcggtgacctcatcggctcgccgatggagatgttc
aaggcccgcaagtgcggcatgaccgcggcccgcaacatcatgggcgacccctacgagttc
gacttctccgagtacccggacttcctccacaccacgtacgaggtcacgtgggtgggtctc
tccgaggaggaggcgcgcgcagagtacggcgacatcgctgtcatccagatgccgcccaag
ggcatccgcgacgacgagcttgccctcccgtgcgccgaggggtccatgctctacgccttc
acccggcccgagctcaccggcttccagaaggccgtctacgacgggaagactcgtcggctg
ctcggcgcacaccacgtcggtttcggcgccaaggacgccttccagtacctcgatcacctc
atccgcaaggggatcaccgtcgacgagatgggcgagatgaatgagttgttcctcaacccc
gaccacttcatccagctgtctcgactcagggcaggccaacagcacctcacggacctgtga

DBGET integrated database retrieval system