KEGG   Neoasaia chiangmaiensis: A0U93_15775
Entry
A0U93_15775       CDS       T04705                                 

Definition
(GenBank) hypothetical protein
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
nch  Neoasaia chiangmaiensis
Pathway
nch00626  Naphthalene degradation
nch01100  Metabolic pathways
nch01120  Microbial metabolism in diverse environments
nch01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nch00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    A0U93_15775
Enzymes [BR:nch01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     A0U93_15775
SSDB
Motif
Pfam: DSBA Thioredoxin_4
Other DBs
NCBI-ProteinID: AQS89137
UniProt: A0A1U9KTT8
Position
complement(3394474..3395082)
AA seq 202 aa
MQVEFVYDYRSIYAYLANTQVRTLGADIVFLAVDIVSIMEKVNNQPSPRCPPKARYARVD
SERWARLYGVPLAPNEALLSAMRDGHLPNALLSRAALAARRLEIFEPVNNALFAAVWAGS
DDLATEKGRLLFCEKHRFPASLWHIADSDDIVAELTANNARALAAGVFGVPTFFVGGEMF
FGNDRLGFVRDKVAASQAGDKS
NT seq 609 nt   +upstreamnt  +downstreamnt
atgcaggtcgagtttgtatacgattaccgcagcatatacgcctatctcgcgaacacgcag
gtccggacattgggggcggacatcgtgtttctggccgtcgatatcgtctcgatcatggag
aaggtgaacaatcagccgtctccgagatgccctcccaaggcccggtatgcgcgggttgat
tctgaacgatgggcgcgactttacggcgtacccctcgcgccgaatgaggctctcctgagc
gcaatgcgtgacggacatctgccgaatgccctcctctcccgtgcggcgctggccgctcga
cggctggagatcttcgaacctgtgaacaatgcgctcttcgcggctgtgtgggctggatcg
gacgatctggcgacagaaaaggggcgattgctcttctgcgaaaagcaccgttttccggcc
tctctgtggcatatcgcggactcggacgatattgtcgccgaactgacggccaacaacgcc
cgggctcttgccgccggcgtctttggcgtgcccacatttttcgtgggcggcgagatgttc
ttcggcaacgaccgtctcggatttgtgcgggacaaagtcgccgccagccaggccggagac
aaatcatga

DBGET integrated database retrieval system