KEGG   Naumovozyma castellii: NCAS_0F03390
Entry
NCAS_0F03390      CDS       T02233                                 

Symbol
NCAS0F03390
Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
ncs  Naumovozyma castellii
Pathway
ncs03440  Homologous recombination
ncs03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ncs00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NCAS_0F03390 (NCAS0F03390)
   03450 Non-homologous end-joining
    NCAS_0F03390 (NCAS0F03390)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ncs03400]
    NCAS_0F03390 (NCAS0F03390)
DNA repair and recombination proteins [BR:ncs03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     NCAS_0F03390 (NCAS0F03390)
   NHEJ (non-homologous end-joining)
    MRX complex
     NCAS_0F03390 (NCAS0F03390)
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-GeneID: 11527616
NCBI-ProteinID: XP_003677177
UniProt: G0VH51
Position
6:complement(683109..685694)
AA seq 861 aa
MWVLRYQYDLEDGSTQKISRCIQKSVCYTIGRSNKNHLSIKNDKSISRQHLSLKWEDRND
IHIINQGKLTYIGEQYLDVGQSLTFGNVNSLSIKLGTKPVMVHLEFYSSNWLIPNGLTQF
HETLKDFGVNVATQIPVDQKTQIDLIVDEINGSGLIPLWGFMKDIPVKKPQFFSTACEIL
SSNDNDFDNSWHRLQETSNTLFCSHYISLKDRSRLFENYVILILFDNETNKDAVKTLKTA
LNLGGAIVNDFSDLNASKDYINNLKPTTNQHICLVKFGSFKSPNDQLPDLEYFKLEDIIT
AIRDDKIMKLITTIPEREQVMNQDVSLIPEITYPSDRKTNIQPSHHTVDSIHNDKKNVLS
NRDPGEATLVNPIVKKRRLNRQRVKPLDSLAFFAGGASPKIGSPAVQETAQATKDESAES
DKFRTNNGLTQPSGNSQPLIHSEPIVLKEVLEADHNKNIQEGPTTAVPVIQSKSTQPLEH
TEQNKNSEIGSVAATPTPEVLTGNGVERPNTPQVPSTQALVSNHKEKKNLKSNSLEEPKS
FVQAIQETKNREVTRLKSTMVEIDTDELTEGAINQLGSLVIVEPNQSLIRKKASRCECRT
PTGEDSDKTAREWSRRKNFKKFVKIYPKYMKKDTESDTTDLIRNNAFLITRNYVPMKKFT
GQYNNVPNDDEDMYEHHDYERENIENGDGDLAIPPVVNDFIPSSQLSQRRLQIDSQSARI
KDTQPDFSDDEGQSFSFRRSMANAKKTTANNGLFVVDEDDLDSINIPNHQENVDSVAVRL
DEPYKENKDALNNYTHHSQNSQMIDMDPKSYKRPRKSPPKKPGSRQHKTLIADHDDDDDD
DDYDDDDDDDYGPKFKFRRQN
NT seq 2586 nt   +upstreamnt  +downstreamnt
atgtgggtgcttaggtaccagtatgacttagaagatggatccacacaaaaaatctctcgc
tgcatacaaaaatcagtttgttacactatcggaagatcgaacaagaatcacttgagcatc
aagaacgataagagtatctccaggcaacacctatctttaaaatgggaagatcgaaatgat
atccatattataaaccaggggaaattgacatatattggcgaacaatatttggatgttggg
cagtctttgacttttggtaacgttaacagtttaagtattaaattggggactaaacctgta
atggtacatttagaattctattcttcaaattggctcatacccaatggattaactcaattc
catgaaacattaaaagattttggagttaatgttgcaacgcagataccagtagatcaaaag
actcaaatcgatctgatagttgatgaaataaacggttctgggttgattccattatgggga
tttatgaaagacattcctgtcaagaaaccacaatttttttccacagcttgtgaaatctta
tcttctaatgacaatgattttgacaatagttggcatcgtttgcaagaaacttcaaatacg
ttattttgttctcattatattagtttgaaagacagatctcgtttatttgagaattatgtg
attcttattctatttgacaacgaaactaataaagatgcagttaaaactctgaaaacggca
ttgaacttaggaggagcaattgtcaatgacttttctgatctgaacgcaagtaaagattat
atcaataatttgaaaccaacaactaatcaacatatttgcttagtaaagtttggaagtttc
aagtctccaaatgatcaattaccagatctcgaatattttaagctggaagacataattact
gcaattagagatgataaaataatgaaattaatcacaactattccagaacgtgagcaagtc
atgaaccaagatgtctccttaataccagaaataacatatccctctgatcgtaaaacaaat
atacaacctagtcatcacactgtcgattcaatacataatgacaaaaaaaatgtactatcg
aacagagatcctggggaagcaacactagttaacccaatagtgaaaaaaagaagattaaat
agacaaagagtaaaaccgttagatagtttggcattttttgcagggggtgcaagtccaaag
ataggatcaccagcagttcaagagactgcacaagctacaaaggacgaaagtgcagaatca
gataaattcagaactaacaatggtcttacccaaccttctggaaattctcagccactgatt
cactcagaacctattgttttaaaagaggtattagaggcggaccacaacaaaaatattcaa
gaagggccaactacagctgttcctgttatccagagtaaaagtacgcaacccttagagcat
actgaacaaaacaaaaacagtgaaattggatctgtagcagcaacaccaactccagaagtt
ttaacaggaaacggggttgaaagacctaatactccacaggtaccctccacacaagccttg
gtttcaaatcataaggaaaaaaaaaatctcaagtcaaattcattggaagaacccaaatcg
tttgtacaagccattcaggaaaccaaaaatcgggaagtgacaagattaaaatcaacgatg
gttgaaatagataccgatgaattaactgaaggggcaatcaaccaactaggtagtttggta
attgttgaacctaaccaaagtctaatacgaaaaaaagcatcacgttgtgagtgccggacc
cctactggcgaagacagtgacaaaactgcaagagaatggtcaaggaggaagaacttcaaa
aaatttgtaaaaatatatccaaaatatatgaaaaaggatactgaatcagatactactgat
ttaatcagaaacaatgcgtttctcattacaaggaattatgttccgatgaaaaaattcact
ggacaatacaataatgttccaaatgatgatgaagatatgtatgagcatcatgattatgag
agagaaaacattgaaaatggtgatggggacctagcaattccacctgttgttaatgacttt
attccttcaagtcaattatctcaacgacggttacaaattgacagtcaatctgcaagaatt
aaagatacacaaccagattttagtgatgatgaaggacagtctttttcatttagaagatct
atggcgaatgccaagaaaacaactgctaataatggattattcgtcgttgatgaagatgac
cttgatagtatcaatataccaaatcatcaagaaaatgtcgactctgttgcggtacgtctt
gatgaaccctataaagagaataaggatgcattaaacaattacacacatcattcccaaaac
tctcaaatgatagacatggatccgaaatcttataagaggcctagaaaatctccacctaag
aagccaggctccaggcagcataaaacgctaatagctgatcatgatgatgatgacgacgac
gacgactacgatgatgatgatgacgatgattatggtccgaaattcaagtttagaagacaa
aactag

DBGET integrated database retrieval system