KEGG   Naumovozyma dairenensis: NDAI_0B05680
Entry
NDAI_0B05680      CDS       T02234                                 

Symbol
NDAI0B05680
Name
(RefSeq) hypothetical protein
  KO
K10868  DNA repair protein XRS2
Organism
ndi  Naumovozyma dairenensis
Pathway
ndi03440  Homologous recombination
ndi03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    NDAI_0B05680 (NDAI0B05680)
   03450 Non-homologous end-joining
    NDAI_0B05680 (NDAI0B05680)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:ndi03400]
    NDAI_0B05680 (NDAI0B05680)
DNA repair and recombination proteins [BR:ndi03400]
 Eukaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    MRN(MRX) complex
     NDAI_0B05680 (NDAI0B05680)
   NHEJ (non-homologous end-joining)
    MRX complex
     NDAI_0B05680 (NDAI0B05680)
SSDB
Motif
Pfam: FHA
Other DBs
NCBI-GeneID: 11497771
NCBI-ProteinID: XP_003668844
UniProt: G0W740
Position
2:complement(1384354..1386924)
AA seq 856 aa
MWILRYQYGLEDGGIKKVSICLERSIAYSIGRSSKNPLSIKNDKSISRQHITIKWEPSGQ
LHLVNQGKLTSVKERYLAIDESLIFNVVDTKELDVHLGTNPVIVQIRWQPMNLYIPNMYE
QFRGLLTKYGIEVTSDILQEDSHITAVVMTPNDYYVPLLALALGIPVFKSQYLTEVSNML
RPDNITFDTDVQKINSMESLKLVPSFSLSNNSKNFFQDYFFIITLNKSSVSEHADKSFIL
RKSLQLIGGEEEIIKDPTELQNSVTKILSTSGKNIVIVTDEDNGKRMIMNFECRNVKDIF
DSFVKNDPKLLKSNLTETGVVSPKAPEIFENEKLMVEIQEPPIEAAITEESTSSKNLKHT
PPEPVTTHIVKKRRLARKRVKPLESLDFFVGGSTTGTPFETSSTTLQQEIIEPKVPDVAP
ILNEQIQQSQVNKSINEPAKDIYSIGGSDRKETAALTYATIDKHMQEPTQQIDDIPSQHI
DISPHGNSNEQEKRSNSSEKSPMITQQVNDEKDEKISNAKALKIGKREDSKRYSETTPKS
MVETIQDIKNREVTRLQSSIAHVDAEELTEDAINEFSNLAIVESNASLIRRTENNDNTNK
STNSVVRHDSPDNIMNVLEGRRNFKRFVKVYPKYIQNKNDSNNERGDNGASDFIRNNAFL
ITRNYVPLKQYSKYDDSHGGKNGFNDEEMLEKEYVEYDNEEAGNGLSSTQHENENGVHLS
ATNQAHFQRSRSSQSSYNVDADEDSNEDDNIKSFSFSRTSLPKEPAPNKLFVPDEDEDED
EDEVAAHNLGIDIVNPDVRDVPEVPKRNPEKRKKVSKKSSPKGRGRFIDMENVDNDSVGD
EDDDDDEPKFKFRRKR
NT seq 2571 nt   +upstreamnt  +downstreamnt
atgtggatattgagatatcagtatggattagaagatggaggtattaaaaaggtatcaatt
tgcttggaaagatcgatagcgtacagcattggaagatcaagtaaaaatccattgagtatt
aagaatgataaaagtatctcaagacaacatataactatcaaatgggaaccctcgggtcaa
ttacatctggtaaaccaaggtaaattaacctctgttaaagaaagatacttggccatagat
gaatccttgatttttaacgtcgtagatacaaaagaattagatgttcacttagggacaaat
ccagtgatagtacaaataagatggcaaccaatgaacttatatataccgaacatgtatgaa
caatttaggggattattaactaaatatggtattgaagtgacatctgatattttgcaagaa
gatagccacataaccgctgtagttatgactcccaatgactattatgtgccattgttagca
ctggctctgggaattccagtattcaaatcacagtatttaacagaagtttctaatatgtta
agaccagacaatataacgtttgatacagatgtgcaaaaaataaattccatggaatctcta
aaactagtaccgtcattttcattatcaaacaatagtaagaatttttttcaagattatttt
ttcattattacacttaacaagagttctgtatctgaacatgctgataaatcattcatttta
cgaaaatctctccaattaatcggtggtgaagaagaaataataaaggaccctaccgaatta
caaaactctgtaacaaaaatcctctcaacatcaggaaaaaatattgtaattgtaacagac
gaagacaatggcaaaagaatgattatgaattttgaatgtcgtaatgtaaaagatattttt
gattcctttgtgaagaatgacccaaaattattgaaatcgaatttgactgaaacaggcgtc
gtttctcctaaggctccagaaatatttgaaaatgagaagctaatggtagagattcaagaa
ccacctatcgaagcagctataacagaggaatctacctcgagtaaaaatttaaaacataca
cctccagaacctgtaactacacatatcgttaaaaaaagacgtctagcaagaaaaagagta
aaaccgttggaaagtttagattttttcgttggtggttccaccactggtactcctttcgaa
acctcttcaactacgttacaacaagaaataatcgaaccaaaagttcctgacgtagctcca
attttaaacgaacaaatacagcagtcacaagtaaataaaagcattaatgaacccgcaaag
gatatatattctattggtgggtcggataggaaagaaactgctgcccttacctatgctact
atagataaacatatgcaagaacctacacaacaaatagacgatattccttcacaacatatt
gatatctctcctcatggaaattcaaatgaacaagagaagaggtcaaatagttctgaaaag
tcaccgatgataacccaacaggtgaacgatgaaaaagatgaaaagatatctaatgcaaag
gccttaaaaattggaaaaagagaggattccaaacgatattcagaaactacacctaaatcg
atggtagagaccattcaagatatcaaaaatagagaagttacaagattacaatcatccata
gcacatgttgatgcagaagaattaactgaggatgcaatcaatgaatttagtaatttagcc
attgttgaatcaaatgcatctttaatacgacgaactgaaaacaatgataatactaataag
tcaacgaatagtgttgtaaggcatgattctcctgataatattatgaatgtattggaagga
cgtagaaacttcaaaagatttgttaaagtatatcctaaatatattcaaaataaaaatgat
tcgaataatgaaagaggagataatggtgcatccgacttcatacgaaacaatgcattctta
attacaagaaattatgttcctttgaaacaatatagcaagtacgatgattctcatggtggg
aaaaacgggtttaatgatgaagaaatgctggaaaaagaatatgttgaatatgataatgaa
gaagctggaaatgggctatctagtacacagcacgaaaatgaaaatggtgtacacctatcg
gctacgaatcaagcacatttccaaaggtcgagatctagtcagagttcgtataatgttgat
gctgacgaagacagtaatgaggatgacaatatcaaatcattttcctttagtagaacatca
ttaccaaaggagccagcaccgaacaaactgtttgttccagatgaagatgaagacgaagac
gaagatgaggtagcagctcataatcttggaattgacattgtaaatccagatgttcgagat
gttccagaagttccgaagagaaaccctgagaaaagaaagaaggtatcaaaaaaaagttct
ccaaagggaagaggtcgttttattgatatggagaacgttgacaatgatagtgttggagat
gaagatgacgatgacgatgaacctaagtttaagtttagaaggaaacgataa

DBGET integrated database retrieval system