KEGG   Naumovozyma dairenensis: NDAI_0C03360
Entry
NDAI_0C03360      CDS       T02234                                 

Symbol
NDAI0C03360
Name
(RefSeq) hypothetical protein
  KO
K18713  THO complex subunit THP2
Organism
ndi  Naumovozyma dairenensis
Brite
KEGG Orthology (KO) [BR:ndi00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:ndi03019]
    NDAI_0C03360 (NDAI0C03360)
Messenger RNA biogenesis [BR:ndi03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    TREX complex
     NDAI_0C03360 (NDAI0C03360)
SSDB
Motif
Pfam: THP2 IL5 YecM NAD_binding_5
Other DBs
NCBI-GeneID: 11494741
NCBI-ProteinID: XP_003669239
UniProt: G0W885
Position
3:771983..772789
AA seq 268 aa
MPGEIETTYFDSLSEQEQHLQENYSCIKDIFKTLKQLKNKDATDDELKQNLDNLSIYYRD
LTRSSIDLKYNKYQTREIQLSHLDKISNEAQTFKRKHKTIYLREYVNTTESINGKSLEYI
NLLQRLSVDLVRQIEISDPNVSKINVDGWNPPKKIQVLLDKFGEPDADTRELKIQVQRYL
DDIKMSRAKYSLENKYSLQEKLSEVTKAVNQWRAEWDNIEMMLFGDGSNSMKNMLANVES
IKSKLEEEAKAESKEEEGEGEGNDVEMT
NT seq 807 nt   +upstreamnt  +downstreamnt
atgccaggagaaatagagaccacttattttgactctttaagtgaacaagaacaacattta
caagagaattattcctgcattaaggatattttcaaaactttaaaacaattgaaaaataaa
gatgctactgatgatgaattgaagcaaaatcttgataatttaagcatatattatagagat
ttaacaagaagttccattgatttgaaatataataaataccagactagagagattcaatta
tctcatcttgataagataagcaatgaggctcaaacgttcaagagaaagcataagacgatt
tatttaagagaatatgttaatactactgaaagtattaatggtaaatctttagaatatatt
aatttgttacaaaggttatccgttgatctagttaggcagatagaaatatcggatcctaat
gtttctaagattaatgttgatggttggaatccgccaaagaaaattcaagttttattagat
aaatttggtgagccagatgcggatactcgtgaattaaagatacaagtgcaacgttacctg
gatgatattaagatgtctcgtgctaaatatagtctggaaaataaatattcattacaagag
aaattgagtgaagtgactaaagctgtaaatcaatggagagcggaatgggataatatagag
atgatgttatttggggacggatcgaattcaatgaaaaatatgttagcaaatgtggaatca
attaaaagcaaattagaggaagaggctaaggcagagtcgaaagaagaagaaggggaagga
gaaggaaatgatgtcgaaatgacgtag

DBGET integrated database retrieval system