KEGG   Aspergillus fischeri: NFIA_093720
Entry
NFIA_093720       CDS       T01070                                 
Name
(RefSeq) dimethylallyl tryptophan synthase FtmPT1
  KO
K14132  tryprostatin B synthase [EC:2.5.1.106]
Organism
nfi  Aspergillus fischeri
Pathway
nfi00404  Staurosporine biosynthesis
nfi01100  Metabolic pathways
nfi01110  Biosynthesis of secondary metabolites
Module
nfi_M00786  Fumitremorgin alkaloid biosynthesis, tryptophan + proline => fumitremorgin C/A
Brite
KEGG Orthology (KO) [BR:nfi00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00404 Staurosporine biosynthesis
    NFIA_093720
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01006 Prenyltransferases [BR:nfi01006]
    NFIA_093720
Enzymes [BR:nfi01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.106  tryprostatin B synthase
     NFIA_093720
Prenyltransferases [BR:nfi01006]
 Compound prenylation
  Indole prenyltransferase
   NFIA_093720
SSDB
Motif
Pfam: Trp_DMAT GPS2_interact
Other DBs
NCBI-GeneID: 4588682
NCBI-ProteinID: XP_001261649
UniProt: A1DA62
Position
Unknown
AA seq 518 aa
MFRARLCLTSGSPSLVSSLMPSELDKIPSPGKYSTQSQNSHYNSQSRLLISQHARMPPAP
PDQKPCHLQPAPYRALSETILFGSLNEERWWHSTAPILSRLLISSNYDVDVQYKYLSLYR
HLVLPALGPYPQRDPETGIIATQWRSGMVLTGLPIEFSNNVARALIRIGVDPVTADSGTA
QDPFNTARPKGYLETAARLLPGVDLTRFYEFETELVITKEEEAVLQANPDLFKSPWKSQI
LTAMDLQKSGTVLVKAYFYPQPKSAVTGRSTEELLVNAIRKVDRESRFETQLANLERYME
RRRRGLHVPVVTADKPPPTEADKTFDACSFFPHFLSTDLVEPGKSRVKFYASERHVNLKM
VEDIWTFGGLRRDPDALKGLELLRHFWADIQMREGYYTMPRGFCELGKSSAGFEAPMMFH
FHLDGSQSPFPDPQMYVCVFGMNSRKLVEGLTTFYRRLGWEDMASHYQGNFLANYPDEDF
EKAAHLCAYVSFAYKDGGAYVTLYNHSFNPLGDVALAN
NT seq 1557 nt   +upstreamnt  +downstreamnt
atgtttagagcacgcttgtgtcttacatcgggatcgccgtctttggtgtctagcctcatg
ccctcggagttggataaaattccgtctcctgggaagtattccacccaaagccagaattcc
cactacaattctcagtcacgattactgatttctcagcacgcaaggatgcctccagcacca
ccggaccagaagccttgccacctgcagcccgccccctaccgggccctcagtgaaaccata
ctctttggaagcctcaacgaggagcgctggtggcatagcaccgcgcccatcctctcaagg
ctcctcatatcctccaactacgatgttgacgtgcaatacaagtacctgtcgctgtatcga
cacctggtcctccccgccctgggcccctacccccagcgtgacccagaaacagggatcatt
gcgacgcaatggcgcagtgggatggttcttaccgggttgcccatcgagttcagcaacaac
gtcgcccgggcgttgattcgcattggggtcgatcccgtcacggctgactctggcaccgca
caagacccgttcaacaccgcccgtccgaagggctatctagagaccgccgcccgactcctg
ccgggggttgacctgacacgcttctacgagtttgagaccgagctggtgatcaccaaggaa
gaggaggccgtcctccaagccaacccggacctgttcaagagcccctggaaatcgcagatc
ctcacggccatggacctgcagaaatccgggacagtcctggtcaaggcgtatttctacccg
cagcccaaatctgcagtgactggccgctcgacggaggagcttctggtcaacgccatccgc
aaggtagatcgggagtcgcgcttcgagacgcagctggccaatctggaacggtacatggag
cggcgtcgccggggcctacatgtcccagtcgtcacggcggacaagccaccgcccaccgaa
gcagacaagacgttcgacgcgtgttcattcttccctcattttctgtccaccgacctcgtc
gaacccggcaaatcgcgggtgaagttctacgccagcgagcggcatgtgaatctgaagatg
gtggaggatatctggacctttgggggccttcgaagagatccggatgcactcaagggtctg
gaactgctccggcacttctgggctgatatccagatgcgcgagggttactataccatgccg
cggggcttctgcgagcttggaaagtcgtcggccggtttcgaggcgcctatgatgttccac
ttccatctggacgggagtcagtcgccgtttcccgatccccagatgtatgtctgtgtgttt
gggatgaactcgcggaagcttgttgaggggctaacaaccttctaccggaggcttggctgg
gaggatatggccagtcactaccaggggaattttctagcgaattaccccgatgaggacttt
gagaaggccgcgcacctttgcgcatatgtctcctttgcctacaaggacggcggtgcctac
gtgacgctctacaaccacagtttcaaccctctcggggacgtggcgcttgccaattga

DBGET integrated database retrieval system