KEGG   Nitrobacter hamburgensis: Nham_0825
Entry
Nham_0825         CDS       T00348                                 

Name
(GenBank) hypothetical protein
Organism
nha  Nitrobacter hamburgensis
SSDB
Motif
Pfam: Ntox5 Ntox1 DUF4157 Collagen_mid
Other DBs
NCBI-ProteinID: ABE61701
UniProt: Q1QPZ6
Position
complement(911176..913905)
AA seq 909 aa
MSAHRALAVKAAPAVQTAAPVTLQRTCACEETGEKCPRCAGKRTRLQRFGTGAPPLALPG
AVGDVLRSPGQPMPRALRTRMEEKFGQDFSAVRMHADASAQNSAAAVNARAYTVGRDVVF
ASSAPDLVSTAGQRLLGHELAHVVQQSRGGVAAGIDPDPALEAEAKRAGDAIAAGHPASA
GRAAPVGLQRDAEQPDYPAMEKVTGYVAQALGFNETTSRVVAASLEGGMSGFSHQWNEGK
TGERLGKKFKSFSITDVPDLIKGYLVGVFEGVVSPITDLFAIGVMVEQLNAFVTNLVSSA
ISKAAELANELKGLVDVLAGLGKPIKEFFLGLKSNARETFKMLVGMLNSNGGLVEKAIGF
ARSIGRTQGAAVAKSLESPWEEKTKQPEEKPAGALGYVSNLFGQGRDALIETPWAKVGNK
AGYALGFALIQVVLLVFSEGIGNLITQIGRSLGGLAKAGTFLGRTIEGVTKFVTMAGGII
TKVEEAVNAVVQFLLKPMMPVLEPLLKPLAGMMERMGGFLRKLFGIAEKDAAQVATTAAT
KALGGAHPAPPAPHLPTPATRHPHGPPAKAPVPHGEPHPTPKPVAEPRPAAKATEPHPKP
AAKAPEPAAATPAAKTAEPHPQAMAPEPHKPEPKAPHSASDAAHKPIAEPEPVGGGHHVQ
TTPDGFELCSGPPCPNLRLMYKEQLAADDALRAEMETLEAKRKLAAKLEADGIPDRNFAK
GLNKEAAKLQQKLETAKLHGPTAPKPPPAKPPVAPAPIRGSAKPAPGEALVGSSTSQMRR
RSAKLIASDPDHPLGFLLNKRGRFRSQRGLKHHELMERPDIVQMGHIRSNKLGEDEFVML
QGGWENQFNNVTIEMSHIRGAVLDQPAVSIGGVVVDLKTAQYWENVGLLKRGTVACSPRV
QLPISDIAK
NT seq 2730 nt   +upstreamnt  +downstreamnt
atgagcgcgcaccgcgccctggccgtgaaggcggcgcccgccgtccagacagccgcgccg
gtgacgctgcagcggacctgcgcctgcgaggaaacgggcgagaagtgtcctcgctgcgcc
ggcaagcgcacgcgcctgcagcggttcggaacaggcgcgccgccactcgcactgcctggt
gcggtcggcgacgtgctgcgcagccccggccagcccatgccgcgtgcgctgcgcacgcgg
atggaagagaagttcggccaggatttctcggccgtgcgcatgcatgccgatgcgtcggcg
cagaactccgccgcggcggtcaacgcgcgtgcctacaccgtcggccgggatgtcgtgttc
gccagctcagcaccggaccttgtcagcacggcgggccagcggctgctcgggcacgagctt
gcgcatgtcgtgcagcagtcgcgcggcggcgtggcagcgggcatcgatcccgaccccgcg
ctggaggccgaggcgaaacgggcgggcgacgcgattgccgcgggacacccggccagcgcc
ggcagggccgcgccggtcggcctgcagcgcgacgctgagcagcccgactatcccgcgatg
gagaaggtgaccggctatgtcgcgcaggcgctcggcttcaacgagaccacttcacgcgtc
gttgctgccagcctcgaaggcggaatgtccggcttctcccaccagtggaacgagggcaaa
accggcgagcggctcggcaagaagttcaagagcttctcgatcaccgatgtgcccgacctt
atcaaaggctatctcgtcggcgtgttcgaaggcgtggtcagtccgatcacggatctgttc
gccatcggcgtgatggtcgagcagctcaatgcattcgtgaccaacctggtgtcgagcgcc
atctcgaaggcagccgaactcgcgaacgaactgaaaggcctcgtcgacgtgctcgccggt
ctcggcaagccgataaaggaattcttcctcggtctgaaaagcaatgcccgcgagacgttc
aagatgctggtcggcatgctgaacagcaacggcggcctcgtcgagaaggccatcggtttc
gcgcgctcgatcgggcggacgcagggcgcggcagtggccaaatcgctggagtcgccctgg
gaagaaaagacgaagcaaccggaagagaaaccggccggcgcgctcggctacgtctcgaac
ctcttcggccagggccgcgacgcgctgatcgagacgccctgggcgaaggtcggcaacaag
gccggctatgcgctcggcttcgcgctcatccaggtcgtgctgctcgtcttctccgaaggc
atcggcaacctcatcacgcagatcggccgcagcctcggcgggctcgccaaggcgggcact
ttcctcggccgcacgatcgagggcgtcacaaaattcgtgaccatggcgggcggcatcatc
accaaggtcgaggaggccgtgaacgccgtcgtccagttcctcctgaagccgatgatgccg
gtgctggagccgctcctgaaaccgctcgctggcatgatggagcggatgggcggcttcctg
cgcaagctcttcggcatcgccgagaaggatgccgcgcaggtcgcgaccacggccgccacg
aaggcactgggcggcgcgcatccggcgccgcccgcaccgcatctgccaacgcccgccacg
cgccatccgcatgggccgcccgcgaaggcgcccgtgccgcacggcgagccgcacccgacg
ccgaaacccgtggcggagccgcgtcccgcagcgaaggcgaccgagccgcatccaaagccc
gcggcgaaagcgcccgagcccgccgccgcgacgccggccgccaagaccgcggagccacat
ccgcaagccatggcgccggagccgcacaagccggaaccgaaggctccgcattccgcctcc
gacgccgcgcacaagccgatcgccgagccggagcccgtcggcggcggccaccatgtgcag
acgacacccgacggcttcgaactgtgcagcgggccaccctgtccgaacctgcgcctgatg
tacaaggaacagcttgccgccgacgacgcgctgcgtgccgaaatggaaacactagaagcc
aaacgtaagctcgctgcgaagctcgaagccgatggtatcccggatcgcaatttcgcaaaa
ggcctcaataaagaggcagccaaactccagcaaaagcttgaaacagcgaaactccatggg
ccaaccgcgcccaaaccgccacctgcaaagccgcccgtcgcacctgcccctattagggga
tcggcgaagccagcaccgggggaggccttggtcggatcaagtacgagtcagatgcgcaga
agatctgccaagctcatcgcgagcgaccccgatcatccgctcggctttttgctcaacaaa
cgcggacgtttcagatcccagcgcgggctcaaacaccacgagctgatggagcggccagac
atcgtgcagatgggtcatatccgcagcaacaagctcggcgaggatgagtttgtgatgctg
caaggcggttgggaaaatcagttcaacaacgtgacgatcgagatgtctcatatacggggc
gccgttctagatcagccggcggtttcgatcggcggcgtcgttgtggatttgaaaacggcg
caatactgggaaaacgttggcctgcttaagcgcggaacagtcgcgtgctcaccacgggtt
caacttccaatatcggatatcgccaaatga

DBGET integrated database retrieval system