KEGG   Nocardia huaxiensis: H0264_36130
Entry
H0264_36130       CDS       T07784                                 
Name
(GenBank) DegT/DnrJ/EryC1/StrS family aminotransferase
  KO
K13547  L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase [EC:2.6.1.100 2.6.1.101]
Organism
nhu  Nocardia huaxiensis
Pathway
nhu00524  Neomycin, kanamycin and gentamicin biosynthesis
nhu01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nhu00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    H0264_36130
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:nhu01007]
    H0264_36130
Enzymes [BR:nhu01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.100  L-glutamine:2-deoxy-scyllo-inosose aminotransferase
     H0264_36130
    2.6.1.101  L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase
     H0264_36130
Amino acid related enzymes [BR:nhu01007]
 Aminotransferase (transaminase)
  Others
   H0264_36130
SSDB
Motif
Pfam: DegT_DnrJ_EryC1 Aminotran_1_2
Other DBs
NCBI-ProteinID: QLY30486
UniProt: A0A7D6Z1P6
Position
complement(7885399..7886706)
AA seq 435 aa
MLAIHGGPPVRRAASWPRWPQYDESTERELLAALRSERWSVSWYAPDGGKSRERLFGEAF
ARYHDAAYGVSVDHGSSALVIALEALGVGPGDEVIVPAVTWVAPATAVLRVGATPVLVDV
DPESGCLTGESIRDGLSARTRAVIAVHLACTTVDLDDVPAATLATGLPLIEDCSQAHGAR
WAGRAVGTFGNAGVFSLGAAKTLAGGEGGAVITDRQHLYQRMLQLRADSRGYTPGVPGVG
EYELVERGEIMGANYCMSELTAAVLLDQLPRLDAQNELREQRAKELEAGLADIPGLAPVP
VPAPVDRRAIYEYGIRVCPGAFGAAPVEAVAAALTAELGTRVYPPRDPLHRSILLRPRTK
PRFARLPDATWDRMTGRDFPGADHYRDHTLLLHHSVLLGDTADIDGILTALDKVRTRSDA
LSAASGCSLTKGARP
NT seq 1308 nt   +upstreamnt  +downstreamnt
atgctggccattcatggcggcccaccggtccgccgcgccgcgtcctggccgcgctggccg
cagtacgacgagagcaccgagcgagaactgctcgccgccttgcgctccgagcgctggtcg
gtcagctggtacgcccccgacggcggcaaatcccgggagcggctgttcggtgaggcgttc
gcgcgctaccacgacgcggcctacggggtgagcgtcgaccacggctcgagtgcactggtg
atcgctttggaagcactgggcgtgggccccggcgacgaggtgatcgttccggctgtcacc
tgggtggctccggccacggcggtgctgcgcgtgggtgcgacaccggtgctggtggatgtg
gatcccgaatccggctgcctcaccggcgaatccattcgcgacgggctctcggcgcggacg
cgggccgtgatcgcggtccatctcgcctgcaccaccgtcgatctcgacgatgtcccggcg
gccaccctcgccacggggctgccgctgatcgaggactgctcacaggcgcacggcgcgcgc
tgggcgggccgtgcggtcggcaccttcggcaatgcgggcgtgttcagcctcggcgcggcc
aaaaccctggcgggcggcgagggtggcgcggtgatcaccgaccggcagcacctttatcag
cgaatgcttcagctgcgcgcggattctcgcggctacacgccgggcgtacccggggtcggc
gagtacgagctggtcgaacgcggtgagatcatgggcgcgaactactgcatgtcggaactg
acagcggcggtgttgctggatcagctgccccggctcgacgcccagaacgaactgcgggag
cagcgcgccaaggaactcgaggccgggctcgcggacatccccgggctcgcgcccgtgccc
gtgcccgcgccggtcgatcgacgggccatctacgagtacggaatccgtgtgtgtcccggc
gctttcggcgccgcgccggtcgaggcggttgccgccgcactgaccgccgagctgggtacc
cgcgtctatccgccgcgagatccgttgcaccgcagcatcctgctgcgcccccggacgaag
ccgcgtttcgcgcgcctgcccgatgccacgtgggatcgcatgaccggccgggatttcccc
ggggcagaccactaccgggatcacaccctgctcctgcaccacagcgtcctgctgggcgat
acggccgacatcgacggcatcctcaccgcgctcgacaaggtccgtacccgctccgacgcc
ctgtccgccgcctccggctgctcgctcacgaaaggcgctcgcccatga

DBGET integrated database retrieval system