KEGG   Nocardia iowensis: KV110_24655
Entry
KV110_24655       CDS       T07470                                 

Name
(GenBank) FAD-binding oxidoreductase
  KO
K19191  4-methylaminobutanoate oxidase (formaldehyde-forming) [EC:1.5.3.19]
Organism
nie  Nocardia iowensis
Pathway
nie00760  Nicotinate and nicotinamide metabolism
nie01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nie00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    KV110_24655
Enzymes [BR:nie01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.3  With oxygen as acceptor
    1.5.3.19  4-methylaminobutanoate oxidase (formaldehyde-forming)
     KV110_24655
SSDB
Motif
Pfam: DAO FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like Pyr_redox ThiF GMC_oxred_N FAD_binding_3 Lycopene_cycl
Other DBs
NCBI-ProteinID: QXN88773
Position
5366324..5367565
AA seq 413 aa
MSDHADVVVIGGGILGCTLALHLIESGAGSVRLLERDGLFQGTSAAGAGFLASWTPFAAE
QAVAGYSLDYYARLQAEGHDIDLRSNGILSLDARASSLQEISDSGAEYGEQATVVDAAEV
EALTHGLVAGSGIAGGLFEPGGAQVFAPKVGAALAERLHRHPGVVDSRRPVTALRTRGGR
IVGVETATGTIDCAAVVVAAGAWSNELLAPLGIFLPTAPQITSRIITENLDLPSTLPALF
LSGLIPEDTDGGTLLWVRWHAGGLLWGGTYDTYPRNILLDAPMPERLDEIPYDGVRELLR
VAARADTVMPVLARQSSITVKHGAPCYTPDWRALVGPVAAVEGLYALTGDNEAGLTHGPG
YAKVLTDLLLHGTSDLTSAADWSPNRFNDRYTTQTAVIEAFLDYETSFSTSSS
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgtctgaccacgccgacgtcgtcgtcatcggtggcggaatattggggtgcacactagct
ttgcacctgatcgaatccggggccggaagtgtccggctgctggaacgcgacgggctcttt
cagggcaccagcgcagccggtgccgggttcctggcgagctggacgccattcgcggcggag
caagccgtggcaggctacagcctggattactatgcccggttgcaagccgaaggccacgac
atcgacctgcgtagcaacggaattctgtcgttggacgcccgcgcgtcctcgttgcaggaa
atcagcgacagtggtgcggagtacggcgagcaagcgactgttgtggatgcggccgaagtc
gaggcactgacccatggcctggtcgcgggcagtggaatagctggcggactgttcgagcca
ggcggtgcgcaggtcttcgcgccgaaggtcggggcagcccttgccgagcggctgcaccgt
caccccggagtggtcgactcgcggcggccggttaccgcgctgcgtacccgcggcggtcgt
atcgtcggcgtcgaaaccgccaccgggacaattgattgtgcggcggtggtggtggctgcg
ggcgcgtggagcaatgaattgctcgctcccctcggcatattcctgcccaccgcaccgcag
atcacctcacggatcatcaccgagaacctcgatctgcccagcacgctgcccgctctgttc
ctttcgggtctgattcccgaggacaccgacggcggaacactgttgtgggtgcgctggcac
gccggtggcttgctgtggggcggcacctacgatacgtacccgcgcaacatcctcctcgac
gccccgatgccggagcggctcgacgagatcccttacgacggtgtgcgggaactgctgcga
gtggccgcacgcgccgacaccgtgatgccggttctggcccggcaatcgagcatcacggtc
aaacacggcgcaccctgctacacccctgattggcgcgcactggtcgggcctgtcgccgcc
gtcgagggcctctacgccctgaccggagataacgaagccggactcacccacggccccggc
tacgccaaggtcctcaccgacctactcctgcacggaaccagcgacctgacctccgccgcc
gactggagccccaaccgtttcaatgatcgatacaccacccaaaccgccgttatcgaggcc
tttctcgactacgagacatcattttccaccagctcgagctga

DBGET integrated database retrieval system