KEGG   Nitratireductor kimnyeongensis: KW403_06755
Entry
KW403_06755       CDS       T07526                                 

Name
(GenBank) LysE family transporter
  KO
K16327  putative LysE/RhtB family amino acid efflux pump
Organism
nki  Nitratireductor kimnyeongensis
Brite
KEGG Orthology (KO) [BR:nki00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:nki02000]
    KW403_06755
Transporters [BR:nki02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   KW403_06755
SSDB
Motif
Pfam: LysE TerC
Other DBs
NCBI-ProteinID: QZZ36821
Position
complement(1434915..1435538)
AA seq 207 aa
MDALLFGKSLLLGLAVAAPLGPIGALCVNRTLEHGLWAGMAGGLGTALADAVYAALAAIG
FAAFAAALAVVDVPLKLVGGAFLAWLGWKSFSPAPLRAAATVRASNLFGTAAATFFLTIT
NPMTILAFAAMFAGLGLADSPQPADAAVVVTGVFLGSLLWWFFLSGGVALARARLPDAVS
LWVSRISGLILLAFAAFAIGSVMRNYL
NT seq 624 nt   +upstreamnt  +downstreamnt
ttggacgcgctgcttttcggcaagagcctcctgctcgggctggccgtcgcggcgccgctc
ggtccgatcggtgctctatgcgtgaacagaacgctggaacatggcctttgggcaggtatg
gctggcggtctgggcacggcccttgccgatgctgtctatgcggcgctggcggcgatcgga
tttgcagcctttgctgcggctctcgcggtggtcgatgtgccgctcaagcttgtcggcgga
gcgtttctggcgtggcttgggtggaaaagcttttcgcccgcacccctgcgggcagcggcc
acagtgcgggccagcaatctcttcgggaccgctgccgccaccttttttctgacgatcacc
aatccaatgaccattttggcctttgcggccatgtttgctggtcttggactggcagattct
ccacagcccgcagatgcggcggtcgtggtgacaggggtctttctgggctcgcttctctgg
tggttctttctgagcggtggcgtggcattggcgcgcgcacggttgcctgacgccgtttcg
ctatgggtatcgcggatctccggtttgatcctgctggcatttgcggctttcgcgataggc
tccgtgatgcgaaattatctctga

DBGET integrated database retrieval system