KEGG   Nomascus leucogenys (northern white-cheeked gibbon): 100593175
Entry
100593175         CDS       T03265                                 

Definition
(RefSeq) cytochrome P450 3A4 isoform X3
  KO
K17689  cytochrome P450 family 3 subfamily A4 [EC:1.14.13.32 1.14.14.55 1.14.14.56 1.14.14.57 1.14.14.73 1.14.14.-]
Organism
nle  Nomascus leucogenys (northern white-cheeked gibbon)
Pathway
nle00140  Steroid hormone biosynthesis
nle00591  Linoleic acid metabolism
nle00830  Retinol metabolism
nle00980  Metabolism of xenobiotics by cytochrome P450
nle00982  Drug metabolism - cytochrome P450
nle00983  Drug metabolism - other enzymes
nle01100  Metabolic pathways
nle04976  Bile secretion
nle05204  Chemical carcinogenesis - DNA adducts
nle05207  Chemical carcinogenesis - receptor activation
Brite
KEGG Orthology (KO) [BR:nle00001]
 09100 Metabolism
  09103 Lipid metabolism
   00140 Steroid hormone biosynthesis
    100593175
   00591 Linoleic acid metabolism
    100593175
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    100593175
  09111 Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100593175
   00982 Drug metabolism - cytochrome P450
    100593175
   00983 Drug metabolism - other enzymes
    100593175
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    100593175
 09160 Human Diseases
  09161 Cancer: overview
   05204 Chemical carcinogenesis - DNA adducts
    100593175
   05207 Chemical carcinogenesis - receptor activation
    100593175
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nle00199]
    100593175
Enzymes [BR:nle01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.32  albendazole monooxygenase
     100593175
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.55  quinine 3-monooxygenase
     100593175
    1.14.14.56  1,8-cineole 2-exo-monooxygenase
     100593175
    1.14.14.57  taurochenodeoxycholate 6alpha-hydroxylase
     100593175
    1.14.14.73  albendazole monooxygenase (sulfoxide-forming)
     100593175
    1.14.14.-  
     100593175
Cytochrome P450 [BR:nle00199]
 Cytochrome P450, animal type
  CYP3 family
   100593175
SSDB
Motif
Pfam: p450 Coa1
Other DBs
NCBI-GeneID: 100593175
NCBI-ProteinID: XP_004090951
Ensembl: ENSNLEG00000011206 ENSNLEG00000026826
Position
17
AA seq 451 aa
MDLIPNLAVETWLLLAVSLVLLYLFYDGRQPVLAITDPDMIKTVLVKECYSVFTNRRPFG
PVGFMKSAISIAEDEEWKRIRSLLSPTFTSGKLKEMVPIIAQYGDVLVRNLRQEAETGKP
VTLKDVFGAYSMDVITSTSFGVNIDSLNNPQDPFVENTKKLLRFDFLDPFFLSIIVFPFL
TPILEVLNISVFPREVTSFLRKSVKRMKESRLKDTQKHRVDFLQLMIDSQNSKETESHKA
LSDLELVAQSIIFIFAGYETTSSVLSFIMYELATHPDVQQKLQEEIDAVLPNKAPPTYDT
VLQMEYLDMVVNETLRLFPIAMRLERVCKKDVEINGMFIPKGVVVMIPSYVLHHDPKYWT
EPGKFLPERFSKKNKDSIDPYIYTPFGTGPRNCIGMRFALMNMKLALIRVLQNFSFKPCK
ETQIPLKLHSGGLLQPEKPIVLKVESRDGTV
NT seq 1356 nt   +upstreamnt  +downstreamnt
atggatctcatcccaaacttggccgtggaaacctggcttctcctggctgtcagcctggtg
ctcctctatctcttttatgatggtcgacagcctgtgctggctatcacagatcctgacatg
atcaaaacagtgctagtgaaagaatgttattctgtcttcacaaaccggaggccttttggt
ccagtgggatttatgaaaagtgccatctctatagctgaggacgaagaatggaagagaata
cggtcattgctgtctccaaccttcaccagtggaaaactcaaggagatggtccctatcatt
gcccagtatggagatgtgttggtgagaaatctgaggcaagaagcagagacaggcaagcct
gtcaccttgaaagacgtttttggggcctacagcatggatgtgatcactagcacatcattt
ggagtgaacatcgactctctcaacaatccacaagacccctttgtggaaaacaccaagaag
cttttaagatttgatttcttagatccattctttctctcaataatagtctttccattcctc
accccaattcttgaagtattaaatatctctgtgtttccaagagaagttacaagtttttta
agaaaatctgtaaaaaggatgaaagaaagtcgcctcaaagatacacaaaagcaccgagtg
gatttccttcagctgatgattgactctcagaattcgaaagaaactgagtcccacaaagct
ctgtctgatctggagctcgtggcccaatcaattatctttatttttgctggctatgaaacc
acgagcagtgttctctccttcattatgtatgaactggccactcaccctgatgtccagcag
aaactgcaggaggaaattgatgccgttttacccaataaggcaccacccacctatgatact
gtgctacagatggagtatcttgacatggtggtgaatgaaacgctcagattattcccaatt
gctatgagacttgagagggtctgcaaaaaagatgttgaaatcaatgggatgttcattccc
aaaggggtggtggtgatgattccaagctatgttcttcaccatgacccaaagtattggaca
gagcctgggaagttcctacctgaaagattcagcaagaagaacaaggacagcatagatcct
tacatatacacaccctttggaactggacccagaaactgcattggcatgaggtttgctctc
atgaacatgaaacttgctctaatcagagtccttcagaacttctccttcaaaccttgtaaa
gaaacacagatccccctgaaattacactcaggaggacttcttcaaccagaaaaacccatt
gttctaaaggttgagtcaagggatggcaccgtttaa

DBGET integrated database retrieval system