KEGG   Nonomuraea sp. ATCC 55076: BKM31_21910
Entry
BKM31_21910       CDS       T04759                                 

Name
(GenBank) glycoside hydrolase family 15
  KO
K22308  isomaltose glucohydrolase [EC:3.2.1.205]
Organism
noa  Nonomuraea sp. ATCC 55076
Brite
KEGG Orthology (KO) [BR:noa00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BKM31_21910
Enzymes [BR:noa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.205  isomaltose glucohydrolase
     BKM31_21910
SSDB
Motif
Pfam: Glyco_hydro_15
Other DBs
NCBI-ProteinID: AQZ63761
UniProt: A0A1V0A0L5
Position
complement(4895210..4896295)
AA seq 361 aa
MSLVAHSLDVIKRLQASSGAYPASPTFSAYRGYSWLRDGAFIAEGVSRHGDAAGADAFHA
WCARVVGDRAGQVDVLVSRAARGEPVTAAEMLPTRFTLDGVDGDDDWWDFQLDGYGTWLW
ALREHVARHGRAVPGTDKGVRTAARYLTAFWHLPCYDWWEEHVEHRHVATLGSIHAGLRA
AIALGVLSGAESATAAEAVEGVAALVAREGVHERGHLRKWLGSDAVDGSLLACVEPFGLY
PAGHPVGEATVAEVERQLARDGGVYRYLEDTFYGGGRWLLLAGFLGWNHARAGRREQAAR
YLEWMAAQATPAGDLPEQVSDLLLAPDRRQEWLERWGPVATPLLWSHGMYLILADELGVT
A
NT seq 1086 nt   +upstreamnt  +downstreamnt
ttgtccctcgtcgcgcacagcctcgacgtgatcaagcgtctgcaggcgtcttcaggggcc
tacccggcctcgcccaccttttccgcctaccgcggctactcctggctgcgcgacggcgcg
ttcatcgccgagggggtgagcaggcacggcgacgcggccggcgcggacgccttccacgcc
tggtgcgcccgggtcgtcggcgaccgcgcgggccaggtggacgtgctggtgtcccgcgcg
gcgcgcggcgagccggtcacggcggccgagatgctgccgacccgcttcacgctggacggc
gtggacggcgacgacgactggtgggacttccagctcgacgggtacggcacatggctctgg
gcgctgcgcgagcacgtcgcccggcacggcagggcggtgcccggcaccgacaagggcgtc
aggacggcggcccgctacctgaccgcgttctggcacctgccctgctacgactggtgggag
gagcacgtcgagcaccgccacgtggccacgctcggctcgatccacgcgggactgcgggcg
gcgatcgcgctcggcgtgctgagcggcgcggagtcggcgacggcggccgaggccgtcgag
ggcgtcgccgcgctcgtggcccgcgagggcgtccacgagcggggacacctgcgcaagtgg
ctcggcagcgacgccgtggacggcagcctgctggcctgcgtcgagccgttcggcctgtac
ccggccgggcatccggtcggcgaggcgacggtcgccgaggtggagcggcagctcgctcgc
gacggcggcgtgtaccgctacctcgaagacaccttctacggcggcggccggtggctgctg
ctggccgggttcctcggctggaaccacgcccgcgccgggcggcgggagcaggccgcgcgc
tacctggagtggatggcggcgcaggcgaccccggcgggcgacctgcccgagcaggtgtcg
gacctgctgctggcccccgaccggcggcaggagtggctggagcggtgggggccggtggcc
acgccgctgctgtggtcgcacggcatgtacctgatcctcgccgacgagctgggggtgacg
gcgtga

DBGET integrated database retrieval system