KEGG   Novosphingobium sp. Gsoil 351: GKE62_05170
Entry
GKE62_05170       CDS       T06443                                 

Definition
(GenBank) 2-hydroxychromene-2-carboxylate isomerase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
nog  Novosphingobium sp. Gsoil 351
Pathway
nog00626  Naphthalene degradation
nog01100  Metabolic pathways
nog01120  Microbial metabolism in diverse environments
nog01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nog00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    GKE62_05170
Enzymes [BR:nog01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     GKE62_05170
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: QGN54021
UniProt: A0A6I5WVL4
Position
1087269..1087856
AA seq 195 aa
MTRTIDFYFDFISPFSYLAQLKLPALARRTECELDFWPIDIPEAKIAAGNYGPSNREVPP
KIKVMMADLERWAAKYEVRLRFPASFACADWNCATLYAREQGNAELFVAAAFHRIWGLGI
DPRDRDELRACAVETGLDPDAAIAFVESSLGQNEYRKVRSMAYQRGVFGAPMMFVDDQIF
WGNDRLDFLENYLIK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgacccgcaccatcgacttctatttcgatttcatcagccccttcagctaccttgcgcag
ttgaagctgccagcccttgcccgccggaccgagtgtgaactcgacttttggccgatcgac
attccggaagctaagatcgcggccggaaactatggcccgtccaatcgcgaggtccccccc
aagatcaaggtcatgatggccgatctggaacgctgggcggcgaagtacgaggttcgcttg
cggtttccggccagctttgcctgcgccgactggaactgcgcgaccctttatgcccgcgaa
cagggcaacgccgagctgttcgtcgctgcagcgtttcaccgcatctggggcttgggcatc
gatccgcgcgatcgtgacgaactgcgcgcgtgtgccgtcgagaccggcttggatcccgac
gcagccattgcttttgtcgaatcatcgctcgggcagaatgaataccggaaggtgcgcagc
atggcatatcagcgcggcgtctttggggctcctatgatgtttgtcgatgatcaaattttc
tggggcaatgatcgcctggatttccttgagaattatttgataaaatga

DBGET integrated database retrieval system