KEGG   Nordella sp. HKS 07: G5V57_22445
Entry
G5V57_22445       CDS       T06462                                 

Name
(GenBAnk) N-acyl homoserine lactonase family protein
  KO
K18610  4-pyridoxolactonase [EC:3.1.1.27]
Organism
noh  Nordella sp. HKS 07
Pathway
noh00750  Vitamin B6 metabolism
noh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:noh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    G5V57_22445
Enzymes [BR:noh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.27  4-pyridoxolactonase
     G5V57_22445
SSDB
Motif
Pfam: Lactamase_B Lactamase_B_2 MOR2-PAG1_N
Other DBs
NCBI-ProteinID: QIG50241
UniProt: A0A6G6WY34
Position
complement(4788653..4789459)
AA seq 268 aa
MTDTKVYLLDGGSLVLDGFHVYWNKGPGGEIRFPVYSILVEHKDGRFLIDTGYDYDHVQK
VLPFEKPIQSKDQTIPGALKLIGLEPKDIGVVVNSHFHFDHVGGNKYFPHAKKICHKAEI
QQAMTPEPFEVLGYSDLSFSAAAAEARKTTAQLLAGTTVANSTFEGVEGDVELAKGVKLI
FTPGHAIGHYSLLVEFGSRKPILFTIDASYTKKSLEILCQASFHIDPKAGVASMRRLKQL
AADREAELMYSHDMGEFQTYQTGTKFYG
NT seq 807 nt   +upstreamnt  +downstreamnt
atgaccgataccaaagtctatctgctggatggcggctcgctcgttctggacggctttcat
gtctactggaacaaggggccgggcggcgagatccgcttccccgtctattcgatcctcgtc
gagcacaaggatggccgcttcctgatcgacaccggctatgactacgaccatgttcagaag
gtcctgcctttcgagaagcccatccagtcgaaggaccagacgatccccggcgccttgaag
ctcatcggcctcgaacccaaggatatcggcgtcgtggtcaattcgcatttccatttcgat
catgtcggcggcaacaaatacttcccgcatgccaagaagatctgccacaaggcggaaatc
cagcaggcgatgacgcccgaacccttcgaggtgctgggctattcggatctgagcttctcg
gccgccgccgccgaggcgcgcaagaccacggctcagctgcttgccggcacgaccgtcgcc
aattcgaccttcgaaggcgtggagggcgatgtcgagctcgccaagggcgtaaagctcatc
ttcacgcccggccatgcgatcggccactacagcctgctggtcgaattcggcagccgtaag
ccgatcctgttcaccatcgacgcctcctacacgaagaagagcctcgaaattctttgccag
gcgtccttccatatcgatccgaaggccggcgtcgcctcgatgcgccgactgaagcagctc
gccgccgatcgcgaggccgagctcatgtattcgcacgatatgggcgagttccagacctat
cagaccggcacgaagttctacggctag

DBGET integrated database retrieval system