Nostoc sp. UHCC 0702: JYQ62_27685 Help Entry JYQ62_27685       CDS       T10690                                  Symbol trxA Name (GenBank) thioredoxin   KO K03671   thioredoxin Organism nosu  Nostoc sp. UHCC 0702 Brite KEGG Orthology (KO) [BR:nosu00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03110 Chaperones and folding catalysts [BR:nosu03110]     JYQ62_27685 (trxA) Chaperones and folding catalysts [BR:nosu03110]  Protein folding catalysts   Protein disulfide isomerase    JYQ62_27685 (trxA) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Thioredoxin Thioredoxin_2 Thioredoxin_8 OST3_OST6 Redoxin Thioredoxin_9 AhpC-TSA Thioredoxin_7 Glrx-like HyaE Thioredoxin_3 TraF DUF6568 Thioredoxin_6 Glutaredoxin DIM1 Phosducin Motif Other DBs NCBI-ProteinID:  QSJ15578 Position 6365402..6365728 Genome browser AA seq 108 aa AA seqDB search MPTDIVAYVQESEFDTLLSEEKVLVVDFTATWCGPCRLVSPLMDKLANEYKDRLKVVKVD VDNNKPVFKKYGLRSIPAVLIFKDGELAETIIGVSPYEQFSSAVDKLL NT seq 327 nt NT seq  +upstreamnt  +downstreamnt atgcctactgacatagttgcttacgttcaagaaagcgaatttgatactcttttaagtgaa gaaaaagttctggttgttgactttactgctacttggtgtgggccttgtcgtcttgtgagt ccgttaatggataaacttgctaatgaatacaaagatcgccttaaggttgtcaaggtagac gtggacaacaacaagccagtgtttaaaaaatacggacttcgcagtattccagcggtgtta atttttaaagatggtgaattagcagaaacaatcataggagtttctccttatgaacaattc agcagcgctgttgataagcttctttag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (17) Pfam (17) All databases (18) Download RDF

DBGET integrated database retrieval system