KEGG   Nocardioides piscis: G7071_01355
Entry
G7071_01355       CDS       T07459                                 
Name
(GenBank) hypothetical protein
  KO
K21132  alpha-mannan endo-1,2-alpha-mannanase / glycoprotein endo-alpha-1,2-mannosidase [EC:3.2.1.198 3.2.1.130]
Organism
npi  Nocardioides piscis
Brite
KEGG Orthology (KO) [BR:npi00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    G7071_01355
Enzymes [BR:npi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.130  glycoprotein endo-alpha-1,2-mannosidase
     G7071_01355
    3.2.1.198  alpha-mannan endo-1,2-alpha-mannanase
     G7071_01355
SSDB
Motif
Pfam: Glyco_hydro_99 Glyco_hydro_71 Glyco_tran_WbsX Spore_YtfJ
Other DBs
NCBI-ProteinID: QIK74283
UniProt: A0A6G7YBW1
Position
253806..254999
AA seq 397 aa
MNRLPRFLITVLLVLGTLGTTAPASYANDEVGFPVLAYYYIWYTPTSWDRAKTDLPLLGR
YSSDEKSVMAAHARDAKSAGLDGFLVSWKHTPDLDRRLGLMVETAREHDLTLGIVYQGLD
FFRRPLPPARVADDLRWFVDQYGDDPVFSVQGRPLVIWSGTWESTPRQIGRVTSQVRDRA
RVLASQRSAEEYDAVAPHVDGNAYYWSAMDPYVDTWAQERLDELSAAVHASGGLWIPSVS
PGFDARLVGGHRLIERHDGDTLREEWRLAVNSSPDAVAILSWNEFSENSHVEPSTRYGNE
SLRALASILSATVPDEIAADSSAPGGGAGFPVRPVALLVVAFGTIAGSLSALVRRRLRNR
QGVETTADGPDEDLDLDGWEADDDRLRLALRRRSDPW
NT seq 1194 nt   +upstreamnt  +downstreamnt
atgaaccgactccctcgatttctcatcaccgtgctgctcgtcctggggacactgggaacc
actgcgcctgcgtcgtacgcgaacgacgaggtgggcttccccgtgctcgcctactactac
atctggtacacgccgacctcttgggacagggccaagaccgacctgcccctgctcgggcgc
tactcgagcgacgagaaatcggtgatggcggcgcacgcgcgcgacgcgaagtccgccggt
ctcgacgggttcctggtgagctggaagcacacgccggacctcgatcggcgtctggggctg
atggtcgagactgcacgtgagcacgacctgacgctgggcatcgtctaccagggcctcgac
ttcttccggcggccgctcccgccggcgcgggtcgccgacgacctccgatggttcgtcgac
cagtacggcgacgacccggtcttctccgtgcagggacgtccgctggtcatctggtcgggg
acctgggagtcgactccccgccagatcgggcgggtgacgtcgcaggtccgcgaccgcgcc
cgggtgcttgcctcccagcgcagcgcagaggagtacgacgcggtcgcgccccacgtggac
ggcaacgcctactactggtcggccatggacccatacgtcgacacgtgggcgcaggaacgg
ctcgacgagctgtccgcagccgtgcatgcctcgggcgggctgtggatcccctccgtctcg
ccgggattcgacgctcgactggtgggaggacaccggctgatcgaacgacacgacggcgac
acgctgcgcgaggagtggcggctcgcggtgaactcctcgccggacgctgtggcgatcctc
agctggaacgagttcagcgagaactcgcacgtcgagccgagcacgcgctacggcaacgag
agcctgcgcgcgctcgcatccatcctctccgcgaccgttccggacgagatcgccgccgac
tccagcgctcccggcggcggcgcagggtttcccgtccgtccggtcgcactgctggtcgtg
gcgttcggcaccatcgccggatcgctgtcggcgctcgtgcgacggcggctgcgcaaccgg
cagggggtagagacgacggcggacggaccggacgaggacctcgatctcgacggctgggaa
gcggacgacgaccgcctgaggctggcgctgaggcggaggtccgacccatggtga

DBGET integrated database retrieval system