KEGG   Novosphingobium pentaromativorans: JI59_24555
Entry
JI59_24555        CDS       T03399                                 

Definition
(GenBank) DSBA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
npn  Novosphingobium pentaromativorans
Pathway
npn00626  Naphthalene degradation
npn01100  Metabolic pathways
npn01120  Microbial metabolism in diverse environments
npn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npn00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    JI59_24555
Enzymes [BR:npn01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     JI59_24555
SSDB
Motif
Pfam: DSBA Thioredoxin_4 Thioredoxin_5
Other DBs
NCBI-ProteinID: AIT82629
UniProt: G6EL40
Position
pLA1:complement(26360..26947)
AA seq 195 aa
MTRKIDFYFDFISPFSYLAQLKLPEIARKAGCELEYWPIDIPEAKIAAGNYGPSNREVVP
KIKVMMADLNRWARKYDAPLRFPASFACKDWNCATLYAREQGKAGAFVAAAYNRIWGQGI
DPSDREELRACAAEAGLDAEALTAFVDSSLGQNEYRKVRSQAYQRGVFGAPLMFVDDEIF
WGNDRLEFLEEYLEK
NT seq 588 nt   +upstreamnt  +downstreamnt
atgacccgcaagatcgacttctatttcgacttcatcagtcccttcagctacctcgcgcag
ctgaagctccctgaaatcgcccgcaaggccggttgcgaactcgaatattggccgatcgat
atccccgaggcgaagatcgcggcggggaactacggcccgtccaatcgcgaggtggttccg
aaaatcaaggtgatgatggcggacctcaaccggtgggcccgcaaatacgacgctcccttg
cgttttccggccagctttgcctgcaaggactggaactgcgccacgctctatgcgcgcgag
cagggcaaggcgggagcattcgtcgccgctgcttacaatcgcatctggggacaggggatc
gatccaagcgaccgcgaagaactgcgcgcctgcgcagccgaagccgggcttgatgcagaa
gcgttgactgccttcgtggactcgtcactaggccagaacgaataccggaaggttcgaagc
caagcctatcagcggggagtcttcggcgcgccattaatgtttgtcgacgatgaaatcttc
tggggcaacgaccgcctggagttcttggaagagtacttagaaaaatag

DBGET integrated database retrieval system