KEGG   Novosphingobium sp. PP1Y: PP1Y_AT15569
Entry
PP1Y_AT15569      CDS       T01515                                 

Definition
(GenBank) DsbA oxidoreductase
  KO
K14584  2-hydroxychromene-2-carboxylate isomerase [EC:5.99.1.4]
Organism
npp  Novosphingobium sp. PP1Y
Pathway
npp00626  Naphthalene degradation
npp01100  Metabolic pathways
npp01120  Microbial metabolism in diverse environments
npp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:npp00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    PP1Y_AT15569
Enzymes [BR:npp01000]
 5. Isomerases
  5.99  Other isomerases
   5.99.1  Sole sub-subclass for isomerases that do not belong in the other subclasses
    5.99.1.4  2-hydroxychromene-2-carboxylate isomerase
     PP1Y_AT15569
SSDB
Motif
Pfam: DSBA
Other DBs
NCBI-ProteinID: CCA92435
UniProt: F6ILY3
Position
complement(1643640..1644233)
AA seq 197 aa
MTRKIDFYFDFISPFSYLAQLKLPDIARKAGYELEYCPIDIPEAKIAAGNYGPSNREVAP
KIKVMMADLNRWARKYDVPLRFPASFACADWNCATLYAREQGKAGAYVTAAFNRIWGQGI
DPGDRAELRACATEAGLDPEGLIAFVESPIGQNEYRKARSLAYQRGVFGAPLMFVDDEIF
WGNDRLDFLQEYISQQK
NT seq 594 nt   +upstreamnt  +downstreamnt
atgacccgcaagattgacttctatttcgacttcatcagtcccttcagctacctcgcgcag
ctgaagctgcccgatattgcccgcaaggccggttacgaactcgaatattgcccgatcgat
atccccgaggcgaagatcgcggcggggaactacggcccgtccaatcgcgaggtcgccccc
aagatcaaggtgatgatggcggacctcaaccgctgggcccgcaagtacgacgtccccttg
cggtttccggccagctttgcctgcgccgactggaattgcgccacgctttacgcgcgcgag
cagggcaaggcgggcgcctatgtcaccgccgccttcaatcgcatctggggacagggcatc
gatccgggcgaccgcgcagagctgcgcgcctgcgcaacggaagccggccttgacccagag
gggctgattgccttcgtggaatcgccgatcggccaaaacgaataccgcaaggcccgcagc
ctggcctaccagcgaggcgtgttcggcgcgccattgatgtttgtcgacgatgaaatattc
tggggcaatgaccgcctggattttctgcaagagtatatttcacaacaaaaatag

DBGET integrated database retrieval system