KEGG   Nostoc punctiforme: Npun_F2458
Entry
Npun_F2458        CDS       T00713                                 
Name
(GenBank) homoaconitate hydratase family protein
  KO
K17749  3-benzylmalate isomerase [EC:4.2.1.-]
Organism
npu  Nostoc punctiforme
Pathway
npu00400  Phenylalanine, tyrosine and tryptophan biosynthesis
npu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:npu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Npun_F2458
Enzymes [BR:npu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.-
     Npun_F2458
SSDB
Motif
Pfam: Aconitase Aconitase_C AcnX SLBB
Other DBs
NCBI-ProteinID: ACC81019
CyanoBase: Npun_F2458
CYORF: Npun_F2458
UniProt: B2J8P2
Position
3053077..3054786
AA seq 569 aa
MSHENNVLHLGDDINTDDIIPANRATNDDLDSLKHYALEHVIGAGELLKYDVIEAGENFG
CGSSREIAPIALQAAGITKIRARSFAEIFYRNSINIGLSLEILGEKQENPVVDAIAAAGG
LMSFNQLRRQGQISIPGSLTPPRPMTLVEKLLGLASRNSYVQPGEVVFAQVDLALSHDAV
AGPVAQTFYKQYGEGTKLWDSQKVVLVADHFIQINDIRADDKAYLMYEQMIEFAKFQGCH
LFDVVSPGEATGICHVLLPEKGFVRPGMIIAGTDSHTCTYGALGAFSTGVGTTDMANIYA
TGDMWIRIPPTLVFELSGTLPPKISAKDIILFILGQIGCAGATSKVMEFRGSILAQLPFD
ERLTLANMAVECGAICGLIVPDEVTREYLKNRVSEEFQEIIGDADAEYERVYQFDLSSLE
PQVARPPKPDRVVAISQLENIPITKAFIGSCTGGKLYDLAQAAEVLKGRQLADGVNLFIV
PATIEIREQAQELGYIDIFEQAGAQILKTGCGACINSGFGVLAKEETGIYATNRNFKGRS
GDPTGKNYLASPRTVAISAVNGKISDRFD
NT seq 1710 nt   +upstreamnt  +downstreamnt
atgagtcacgaaaataacgttttgcaccttggtgatgatatcaatactgatgatattatt
cctgctaatcgagctacaaatgatgacctagatagtttaaaacattatgctttagagcat
gttattggagcaggtgaactgctaaaatatgatgtgattgaagcaggagaaaatttcggc
tgtggttccagtcgagaaattgctcccattgccctacaagctgctggaattacaaagatt
cgggcgcgatcgttcgccgagattttttatcgtaatagcatcaatattggactttctcta
gaaattctaggggagaaacaggagaatcctgtagttgatgcgatcgcagcagcaggtggg
ttaatgtcttttaatcagctgcgtcgtcagggtcagattagcattcctgggagcctcact
ccgccaagacctatgactttagtagaaaaactcttgggccttgcctctagaaattcctac
gtccagcctggagaagtggtttttgctcaggtcgatttagcattatcccatgatgctgtg
gccgggcctgtagctcaaacattctataaacagtatggagaaggaacaaagttatgggac
tcccaaaaggtggtcttagtagcagatcacttcatccaaatcaacgacatccgtgctgat
gacaaagcatatctgatgtacgaacagatgattgaatttgctaaattccaaggatgccac
ttatttgatgtggtttccccaggtgaagcaacaggcatctgtcacgttttactaccagaa
aaagggtttgtccgaccagggatgataattgccggtacagattcccatacctgcacctac
ggagcattgggagccttttccacaggcgtgggaacgacagatatggctaatatttatgcc
acaggagatatgtggattcgtattcctccaaccctagtatttgagttgtctggaacctta
cctcctaaaatcagtgccaaagatattatcctgtttattttgggacaaatcggctgtgct
ggcgctactagtaaggtaatggagtttagagggtcaatcctggcacaactgccctttgat
gaacggttgactttagccaatatggccgtggagtgtggtgcaatctgtgggttgattgtt
cctgatgaagtaacccgtgaatatctaaaaaaccgagtttcagaagaatttcaagagatt
atcggcgatgctgatgctgagtacgaaagggtttatcaatttgacctcagcagtttagaa
ccacaagttgcccgtcccccgaaaccagatcgggtagttgccattagtcagttagaaaac
attccgattactaaagcctttattggctcttgtactggaggaaaactctatgacttagct
caagcagccgaagttttaaagggtcgccaactggcagacggtgtaaacttgtttattgta
cctgcaactattgaaattagagaacaagctcaagaattgggctatatcgacatttttgaa
caagcaggggcacaaattctcaagacaggttgtggggcttgtatcaattctggatttggg
gttttagcgaaagaagaaacaggtatttatgcaaccaatcgcaattttaaaggacgcagt
ggcgatccaacgggcaaaaattatttagcctcacccagaacagtagctatctctgctgta
aatggaaaaattagcgatcgctttgattaa

DBGET integrated database retrieval system