KEGG   Nicotiana sylvestris: 104213695
Entry
104213695         CDS       T05026                                 

Name
(RefSeq) 9-divinyl ether synthase
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
nsy  Nicotiana sylvestris
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nsy00199]
    104213695
Enzymes [BR:nsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     104213695
Cytochrome P450 [BR:nsy00199]
 Cytochrome P450, plant type
  CYP74 family
   104213695
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 104213695
NCBI-ProteinID: XP_009761532
UniProt: A0A1U7UZV1
Position
Unknown
AA seq 478 aa
MSSFLVSSNNLPEREIPGDYGFPIISAIKDRYDYFYKQGEDVWFHSKAEKYNSTVVKINM
APGPFTSNDYKLVAFLDANSFVYMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFVDTSD
PNHAALKNYILTSFAKRHNLFIPLFRNSVSDHLFQNLEKQVSDQGKSDFNALLPNMTFGF
IFRLLCDQTNPSDTVLGAQGPEHLRKWLFPQLIPSLSARKLPSFIEDLLFHNFLIPFGLV
KSDYNKLVDAFSKNAGSMLDEAEKLGIKREEAVHNILFLVGINMFAGLNAFFPHLIRFVG
EAGPTLHARLAKEIRTAIKEEGGAVTLSAINKMSLVESIVYETLRLRPPVPLQYGKAKKD
FMVQSHDASYMIKKGQFLVGYQPMASRDPKIFDKPDDFIPDRFMGEGVKMLKHVLWSNGR
ETENPAPDNKQCAGKDLVHLLGRLMLVEFFLRYDTFTVEITPLFRAPNVAIKTLTKAT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttcctttttagtatcatcaaataatcttccagaacgtgaaatcccaggtgactat
ggtttccctattatcagcgccattaaagatcgatacgattacttttacaaacaaggtgaa
gatgtttggtttcatagcaaagctgaaaaatacaattccaccgttgtcaaaatcaacatg
gcaccaggcccattcacctctaatgactacaaattggtggcatttctagatgccaacagc
tttgtctatatgtttgataactctctcattgacaaaactgacactcttggtggtacattc
aagcctggtaaagagtactacggtggttatcgtcctgttgcttttgtcgatacttctgac
cctaaccacgctgctctgaaaaactatattcttacttcattcgctaagcgacataactta
ttcattcctctatttagaaactcagtgtctgatcacctctttcaaaatcttgaaaaacag
gtttctgatcaggggaagtcagatttcaatgcacttctcccgaatatgacgtttggtttc
atttttcgcttgctttgtgaccaaactaatccatctgatacagttcttggcgctcaagga
ccagaacatcttcgcaaatggctttttcctcagcttattccatcattgagtgcgagaaaa
cttcctagctttatagaagatttgctcttccataatttcctgataccatttggtctcgtg
aaaagtgattacaataagcttgttgatgcatttagcaagaatgcagggtccatgttagat
gaagctgagaaacttgggatcaaaagagaggaagctgtacataacatacttttcctcgta
ggaattaatatgtttgccggcttgaatgctttcttccctcatctcatcaggtttgtgggc
gaagcggggcctactctacacgctcgacttgctaaagaaatcaggacagctataaaggaa
gaaggaggggcagtcacattatcagcaatcaacaagatgagtttggtcgagtccatagtc
tatgaaacgttgaggctacgtccaccagtgccactacagtacggtaaggccaaaaaagat
ttcatggtccagagccatgatgcatcttacatgatcaagaaaggtcagttcctcgtcgga
tatcagcccatggctagtagggatcccaagattttcgacaagcccgacgattttatccct
gataggttcatgggagaaggagtgaaaatgctcaaacatgttctttggtctaatggaagg
gaaacagagaatccagcaccagataataagcaatgtgcaggaaaagacttggtgcatttg
ttgggcaggctaatgttggtggagtttttcttgagatatgacactttcaccgtggaaatc
actcctctctttcgcgcaccaaatgttgcaatcaagacattaactaaagcaacttga

DBGET integrated database retrieval system