KEGG   Nicotiana sylvestris: 104229039
Entry
104229039         CDS       T05026                                 

Name
(RefSeq) 5-epi-aristolochene synthase
  KO
K15804  5-epiaristolochene synthase [EC:4.2.3.61]
Organism
nsy  Nicotiana sylvestris
Pathway
nsy00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nsy00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    104229039
Enzymes [BR:nsy01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.61  5-epiaristolochene synthase
     104229039
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2
Other DBs
NCBI-GeneID: 104229039
NCBI-ProteinID: XP_009779916
UniProt: A0A1U7WRI4
Position
Unknown
AA seq 540 aa
YEEEIVRPVADFSPSLWGDQFLSFSIDNEVAEKYAQEIEPLKEQTRSMLLTTGRKLADTL
NLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTSALQFRLLRQHGFNISPEIFSK
FQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAPHLISPLRE
QVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNTVLLRFSKLDYNMLQMLHKQELAEVS
RWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIVDDTFDAYG
TVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGRSHIVCHAIER
MKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGIKSATEHDFEWLSK
NPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGVATKEAMDKFQKMAEKAW
KDLNEGLLRPTPVSVEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHIIALLVDSIEI
NT seq 1623 nt   +upstreamnt  +downstreamnt
tatgaagaagagattgttcgtcccgtggccgacttctcccctagtctctggggtgatcag
ttcctttcattctccattgacaatgaggttgctgaaaagtatgctcaagagattgaacca
ttgaaggaacagacaaggagtatgttgttaacaaccggaagaaaattggctgacacattg
aacttgattgacattattgaacgccttggcatatcctaccactttgagaaagaaattgat
gagattttggatcaaatttataaccaaaactcaaactgcaatgatttgtgcacttctgca
cttcaatttcgattgctcaggcaacatggtttcaacatctctccggaaattttcagcaaa
ttccaagatgaaaatggcaaattcaaggagtctcttgctagtgatgtcttaggattatta
aacttgtatgaagcttcacatgtaaggactcatgctgacgatatcttagaagacgcactt
gctttctccactatccatcttgaatctgcagctccacatttgatatctccacttagggag
caagtgacacatgcccttgagcaatgtttgcacaagggcgttcctagagtcgagacccga
ttcttcatctcatcaatctatgagaaggaacaatcgaaaaatactgtgttacttcgattt
tccaaattggattacaacatgctccagatgttgcacaaacaagaacttgctgaagtatca
aggtggtggaaagatttggatttcgtaacaacacttccatatgctagggatcgagtagtt
gaatgctacttttgggcattaggagtttattttgagcctcaatactctcaagctcgcgtc
atgctcgttaagaccatatcaatgatttccattgtcgatgacacctttgatgcttatggt
acagttaaagaacttgaggcatacacagatgccatacaaagatgggatatcaacgaaatt
gatcggcttcctgattacatgaaaatcagttataaagctattctagatctttacaaggat
tatgaaaaggaattgtctagtgctggaagatctcatattgtctgccatgcaatagaaaga
atgaaagaagtagtaagaaattataatgtcgagtcaacatggtttattgaaggatatatg
ccacctgtttctgaatatctaagcaatgcactggcaactacaacatattactaccttgcg
acaacatcatatttgggtataaagtctgctacggagcatgattttgagtggttgtcaaag
aaccctaaaatccttgaagctagtgtgataatatgccgagttattgatgacacagccacg
tacgaggttgagaaaagcagggggcaaattgcaacaggaattgagtgttgcatgagagac
tatggtgtagcaacaaaagaggcaatggataaattccagaaaatggctgagaaagcatgg
aaggatcttaatgaaggacttcttaggccaactcctgtatctgtagagtttttaactcct
attctcaatcttgctcgtatagttgaggttacatatatacacaatctagatggatatact
catccggagaaagtcttaaaacctcacattatcgccctacttgtggactccatcgaaatt
tga

DBGET integrated database retrieval system