KEGG   Nicotiana tabacum (common tobacco): 107799697
Entry
107799697         CDS       T04643                                 

Symbol
CYP74D3, NtDES1, des1
Name
(RefSeq) 9-divinyl ether synthase
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nta00199]
    107799697 (CYP74D3)
Enzymes [BR:nta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     107799697 (CYP74D3)
Cytochrome P450 [BR:nta00199]
 Cytochrome P450, plant type
  CYP74 family
   107799697 (CYP74D3)
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107799697
NCBI-ProteinID: NP_001312606
UniProt: Q8W2N5 A0A1S4ANT9
Position
Un
AA seq 478 aa
MSSFLVSSNNLPEREIPGDYGFPIISAIKDRYDYFYKQGEDVWFHSKAEKYNSTVVKINM
APGPFTSNDYKLVAFLDANSFVYMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFVDTSD
PNHAALKNYILTSFAKRHNLFIPLFRNSVSDHLFQNLEKQVSDQGKSDFNALLPNMTFGF
IFRLLCDQTNPSDTVLGAQGPEHLRKWLFPQLIPSLSARKLPSFIEDLLFHNFLIPFGLV
KSDYNKLVDAFSKNAGSMLDEAEKLGIKREEAVHNILFLVGINMFAGLNAFFPHLIRFVG
EAGPTLHARLAKEIRTAIKEEGGAVTLSAINKMSLVESIVYETLRLRPPVPLQYGKAKKD
FMVQSHDASYMIKKGQFLVGYQPMASRDPKIFDKPDDFIPDRFMGEGVKMLKHVLWSNGR
ETENPAPDNKQCAGKDLVHLLGRLMLVEFFLRYDTFTVEITPLFRAPNVAIKTLTKAT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttcctttttagtatcatcaaataatcttccagaacgtgaaatcccaggtgactat
ggtttccctattatcagcgccattaaagatcgatacgattacttttacaaacaaggtgaa
gatgtttggtttcatagcaaagctgaaaaatacaattccaccgttgtcaaaatcaacatg
gcaccaggcccattcacctctaatgactacaaattggtggcatttctagatgccaacagc
tttgtctatatgtttgataactctctcattgacaaaactgacactcttggtggtacattc
aagcctggtaaagagtactacggtggttatcgtcctgttgcttttgtcgatacttctgac
cctaaccacgctgctctgaaaaactatattcttacttcattcgctaagcgacataactta
ttcattcctctatttagaaactcagtgtctgatcacctctttcaaaatcttgaaaaacag
gtttctgatcaggggaagtcagatttcaatgcacttctcccgaatatgacgtttggtttc
atttttcgcttgctttgtgaccaaactaatccatctgatacagttcttggcgctcaagga
ccagaacatcttcgcaaatggctttttcctcagcttattccatcattgagtgcgagaaaa
cttcctagctttatagaagatttgctcttccataatttcctgataccatttggtctcgtg
aaaagtgattacaataagcttgttgatgcatttagcaagaatgcagggtccatgttagat
gaagctgagaaacttgggatcaaaagagaggaagctgtacataacatacttttcctcgta
ggaattaatatgtttgccggcttgaatgctttcttccctcatctcatcaggtttgtgggc
gaagcggggcctactctacacgctcgacttgctaaagaaatcaggacagctataaaggaa
gaaggaggggcagtcacattatcagcaatcaacaagatgagtttggtcgagtccatagtc
tatgaaacgttgaggctacgtccaccagtgccactacagtacggtaaggccaaaaaagat
ttcatggtccagagccatgatgcatcttacatgatcaagaaaggtcagttcctcgtcgga
tatcagcccatggctagtagggatcccaagattttcgacaagcccgacgattttatccct
gataggttcatgggagaaggagtgaaaatgctcaaacatgttctttggtctaatggaagg
gaaacagagaatccagcaccagataataagcaatgtgcaggaaaagacttggtgcatttg
ttgggcaggctaatgttggtggagtttttcttgagatatgacactttcaccgtggaaatc
actcctctctttcgcgcaccaaatgttgcaatcaagacattaactaaagcaacttga

DBGET integrated database retrieval system