KEGG   Nicotiana tabacum (common tobacco): 107808154
Entry
107808154         CDS       T04643                                 

Name
(RefSeq) 9-divinyl ether synthase-like
  KO
K17874  9-divinyl ether synthase [EC:4.2.1.121]
Organism
nta  Nicotiana tabacum (common tobacco)
Brite
KEGG Orthology (KO) [BR:nta00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:nta00199]
    107808154
Enzymes [BR:nta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.121  colneleate synthase
     107808154
Cytochrome P450 [BR:nta00199]
 Cytochrome P450, plant type
  CYP74 family
   107808154
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 107808154
NCBI-ProteinID: XP_016488134
UniProt: A0A1S4BGX5
Position
Un
AA seq 478 aa
MSSPLVSSNNLPVREIPGDYGFPIISAIKDRYDYFYKQGEDVWFHSKAEKYKSTVVKINM
APGPFTSNDYKLVAFLDANSFVYMFDNSLIDKTDTLGGTFKPGKEYYGGYRPVAFVDTSD
PNHTALKNYILTSFAKRHNLFIPLFRNSVSDHLFQNLEKQVSDQGKSDFNALLPNMTFGF
IFRLLCDQTNPSDTVLGAQGPEHLRKWLFPQLIPSLSARKLPSFIEDLLFHNFLIPFGLV
KNDYNKLVDAFSKNAGSMLDEAEKLGIKREEAVHNILFLVGINMFAGLNAFFPHLIRFVG
EAGPTLHARLANEIRTIIKEEGGAVTLSAINKMSLVKSIVYETLRLRPPVPLQYGKAKKD
FMVESHDASYMIKKGQFVVGYQPMASRDPKIFDKPDEFVPDRFMGEGEKMLKHVLWSNGR
VTENPAPDNKQCAGKDLVHLLGRLMLVEFFLRYDTFTVEITPLFRAPNVAIKTLTKAT
NT seq 1437 nt   +upstreamnt  +downstreamnt
atgtcttcccctttagtatcatcaaataatcttccagtacgtgaaatcccaggtgactat
ggtttccctattatcagtgccattaaagatcgatacgattacttttacaaacaaggtgaa
gatgtttggtttcatagcaaagctgaaaaatacaaatccactgttgtcaaaatcaacatg
gcaccaggccctttcacctctaatgactacaaattggtggcatttttagatgccaacagc
tttgtttatatgtttgataattctctcatagacaaaactgacactctaggcggcacattc
aagcctggtaaagagtactacggtggttatcgtcctgttgcttttgtcgatacttctgac
cctaaccacactgctctgaaaaactacattcttacttcattcgctaagcgacataactta
ttcattccccttttcagaaactcagtgtctgatcacctctttcaaaatcttgaaaaacag
gtttctgatcaggggaagtcagatttcaatgcacttctcccgaatatgacgtttggtttc
atttttcgcttgctttgtgaccagactaatccatctgatacagttcttggcgctcaagga
ccagaacatcttcgcaaatggctttttcctcagctcattccatcattgagcgcgagaaaa
cttcctagctttatagaagatttgctcttccataatttcctgataccatttggtctcgtg
aaaaatgattacaataagcttgttgatgcatttagcaagaatgcagggtccatgttagat
gaagctgagaaacttgggatcaaaagagaggaagctgtacataacatactttttctcgta
ggaatcaacatgtttgccggcttaaatgcattcttccctcatctcatcaggtttgtgggc
gaagcagggcctactctacacgctcgacttgccaatgaaatcaggacaattattaaggaa
gaaggaggggcagtcacattatcagcaatcaacaagatgagtttggtcaagtccatagtt
tatgaaacgttgaggctacgtccgcccgtgccattacagtacggtaaggccaaaaaagat
ttcatggtcgagagccatgatgcatcttacatgatcaagaaagggcagttcgtcgttgga
tatcagcccatggctagtagggatcccaagattttcgacaaacccgacgagtttgtccct
gataggttcatgggtgaaggagagaaaatgctcaaacatgttctttggtctaatggaagg
gtaacagagaatcctgcaccagataataagcaatgtgcaggaaaagacttggtgcatttg
ttgggcaggctaatgttggtggagtttttcttgagatatgacactttcactgtggaaatc
actcccctctttcgcgcaccaaatgttgcaatcaagacattaactaaagcaacttga

DBGET integrated database retrieval system