KEGG   Nicotiana tabacum (common tobacco): 107821548
Entry
107821548         CDS       T04643                                 

Name
(RefSeq) 5-epi-aristolochene synthase-like
  KO
K15804  5-epiaristolochene synthase [EC:4.2.3.61]
Organism
nta  Nicotiana tabacum (common tobacco)
Pathway
nta00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nta00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    107821548
Enzymes [BR:nta01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.61  5-epiaristolochene synthase
     107821548
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Flu_C_NS1
Other DBs
NCBI-GeneID: 107821548
NCBI-ProteinID: XP_016503461
UniProt: A0A1S4CQX2
Structure
PDB: 

Position
Un
AA seq 550 aa
MASAAVANYEEDIVRPVADFXPSLWGDQFLSFSIDNQVAEKYIYAQEIEALKEQTRSMLL
ATGRKLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCNDLCTSALQFRLLRQHG
FNISPEIFSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESA
APHLKSPLREQVTHALEQCLHKGVPRVETRFFISSIYDKEQSKNNVLLRFAKLDFNLLQM
LHKQELAQVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMIS
IVDDTFDAYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSAGR
SHIVCHAIERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSA
TEQDFEWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGISTKEAMA
KFQNMAETAWKDINEGLLRPTPVSTEFLTPILNLARIVEVTYIHNLDGYTHPEKVLKPHI
IALLVDSIEI
NT seq 1653 nt   +upstreamnt  +downstreamnt
atggcctcagcagcagtagccaactatgaagaagacattgttcgccccgtcgccgacttc
ntccctagtctctggggtgatcagttcctttcattctccattgataatcaagttgcggaa
aagtatatatatgctcaagagattgaagcattgaaggaacaaacgaggagtatgctgtta
gcaaccggaaggaaattggccgatacattgaatttgattgacattattgaacgccttggt
atatcctaccactttgagaaagaaattgatgagattttggatcagatttacaaccaaaac
tcaaactgcaatgatttgtgcacctctgcacttcaatttcgattgctcaggcaacacggt
ttcaacatctctcctgaaattttcagcaaattccaagatgaaaatggcaaattcaaggag
tctcttgctagtgatgtcttaggattattaaacttgtatgaagcttcacatgtaaggact
catgctgacgatatcttagaagacgcacttgctttctccactatccatcttgaatctgca
gctccacatttgaaatctccacttagggagcaagtgacacatgcccttgagcaatgtttg
cacaagggtgttcctagagtcgagacccgattcttcatctcatcaatctatgacaaggaa
caatcgaagaataatgtgttacttcgatttgccaaattggatttcaacttgctccagatg
ttgcacaaacaagaacttgctcaagtatcaaggtggtggaaagatttggattttgtaaca
acacttccatatgctagagatcgagtagttgaatgctacttttgggcattaggagtttat
tttgagcctcaatactctcaagctcgcgtcatgctcgttaagaccatatcaatgatttcg
attgtcgatgacacctttgatgcttacggtacagttaaagaacttgaggcatacacagat
gccatacaaagatgggatatcaacgaaattgatcggcttcctgattacatgaaaatcagt
tataaagctattctagatctctacaaggattatgaaaaggaattgtctagtgccggaaga
tctcatattgtctgccatgcaatagaaagaatgaaagaagtagtaagaaattataatgtc
gagtcaacatggtttattgaaggatatatgccacctgtttctgaatacctaagcaatgca
ctagcaactaccacatattactacctcgcgacaacatcgtatttgggcatgaagtctgcc
acggagcaagattttgagtggttgtcaaagaatccaaaaattcttgaagctagtgtaatt
atatgtcgagttatcgatgacacagccacgtacgaggttgagaaaagcaggggacaaatt
gcaactggaattgagtgctgcatgagagattatggtatatcaacaaaagaggcaatggct
aaatttcaaaatatggctgagacagcatggaaagatattaatgaaggacttcttaggccc
actcccgtctctacagaatttttaactcctattctcaatcttgctcgtattgttgaggtt
acatatatacacaatctagatggatatactcatccggagaaagttttgaaacctcacatt
attgccctgcttgtggactctatcgaaatttga

DBGET integrated database retrieval system