KEGG   Nocardia tengchongensis: KHQ06_25020
Entry
KHQ06_25020       CDS       T07484                                 
Name
(GenBank) DegT/DnrJ/EryC1/StrS family aminotransferase
  KO
K13547  L-glutamine:2-deoxy-scyllo-inosose/3-amino-2,3-dideoxy-scyllo-inosose aminotransferase [EC:2.6.1.100 2.6.1.101]
Organism
ntc  Nocardia tengchongensis
Pathway
ntc00524  Neomycin, kanamycin and gentamicin biosynthesis
ntc01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ntc00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    KHQ06_25020
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ntc01007]
    KHQ06_25020
Enzymes [BR:ntc01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.100  L-glutamine:2-deoxy-scyllo-inosose aminotransferase
     KHQ06_25020
    2.6.1.101  L-glutamine:3-amino-2,3-dideoxy-scyllo-inosose aminotransferase
     KHQ06_25020
Amino acid related enzymes [BR:ntc01007]
 Aminotransferase (transaminase)
  Others
   KHQ06_25020
SSDB
Motif
Pfam: DegT_DnrJ_EryC1
Other DBs
NCBI-ProteinID: QVI19616
UniProt: A0A8E5R2U4
Position
5319290..5320255
AA seq 321 aa
MGASPVLADVDPDTGCLTADELRAVVSSRTRAVIVVHLACTAAELDDIVAVTGQEGLALI
EDCSQAHGTRWAGRAVGTFGAIGVFSLGAAKSLAAGEAGAAITDSRDLYERMLMLRADSR
GYTEDAPGSGEYELVEHGTVMGANYCMSELTAGLLLDQLPRLDDQHTLREQRAKEIEAGL
PDIPGLAPIPVPAPVDRRAVYEYGIRVRPGAFGPATVDQVAAALTAELGTRVYPPRDPLH
RSVLLRPQTKPRFAQWWSEAAERATGRAFTGADHYRDHTLLMHHSVLLGERGDTEDILTA
LDKVRAHADQLAAHPEPKGLA
NT seq 966 nt   +upstreamnt  +downstreamnt
gtgggcgcgagcccggtgctcgccgacgtcgaccccgacaccggctgcctgaccgccgac
gagctgcgcgcggtcgtctcgtctcggacgcgggcggtcatcgtggtgcatctggcctgc
accgcagccgaactcgacgacatcgtcgcggtcaccggccaggaggggctcgcgctgatc
gaggactgctcgcaggcgcacggcacccgctgggccgggcgcgcggtcgggaccttcggc
gcgatcggggtgttcagtctgggagcagccaaatccctggccgccggtgaggctggggcc
gcgatcaccgacagccgtgacctctacgagcgaatgctcatgctgcgcgccgactctcgc
ggatacaccgaggacgcgcccggttcaggggagtacgagctcgtcgagcacggcaccgtg
atgggcgccaactactgcatgtccgaactcaccgccggcctgctgctcgaccagctgccg
cggctcgacgaccagcacacgctgcgcgagcagcgggcaaaggagatcgaagccggtctg
cccgacattcccggactcgcccccatcccggtcccggcgccggtggatcggcgcgcggtc
tacgagtacggaatccgggtgcggcccggcgctttcgggcccgccaccgtcgatcaggtg
gccgcggcgctcaccgccgaactcggcaccagggtctacccgccccgcgatccgctgcac
cgcagtgtgctgctgcgcccgcagaccaaaccgcggttcgcgcaatggtggtccgaggcc
gccgaacgcgccaccggccgcgccttcaccggggccgaccactaccgcgaccacaccctg
ctcatgcaccacagcgtgctcctgggcgagcgcggcgacaccgaggacatcctgaccgcg
ctggacaaggtgcgcgcccacgccgaccagctcgccgcgcacccggaaccgaaaggcctg
gcatga

DBGET integrated database retrieval system