KEGG   Nicotiana tomentosiformis: 104091728
Entry
104091728         CDS       T05025                                 

Name
(RefSeq) 5-epi-aristolochene synthase isoform X1
  KO
K15804  5-epiaristolochene synthase [EC:4.2.3.61]
Organism
nto  Nicotiana tomentosiformis
Pathway
nto00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:nto00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    104091728
Enzymes [BR:nto01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.61  5-epiaristolochene synthase
     104091728
SSDB
Motif
Pfam: Terpene_synth_C Terpene_synth Terpene_syn_C_2 Flu_C_NS1
Other DBs
NCBI-GeneID: 104091728
NCBI-ProteinID: XP_009595428
Position
Unknown
AA seq 548 aa
MAAAAVGNYEEEIVRPVADFSPSLWGDQFLSFSIKNQVAEKYAKEIEALKEQTRNMLSAT
GMKLADTLNLIDIIERLGISYHFEKEIDEILDQIYNQNSNCDDLCISALQFRLLRQHGFN
ISPEIFSKFQDENGKFKESLASDVLGLLNLYEASHVRTHADDILEDALAFSTIHLESAAP
HLKSPLREHVTHALEQCLHKGVPRVETRFFISSIYEKEQSKNNVLLRFAKLDFNLLQMLH
KQELAQVSRWWKDLDFVTTLPYARDRVVECYFWALGVYFEPQYSQARVMLVKTISMISIV
DDTFDAYGTVKELEAYTDAIQRWDINEIDRLPDYMKISYKAILDLYKDYEKELSSTGRSH
IVCHAIERMKEVVRNYNVESTWFIEGYMPPVSEYLSNALATTTYYYLATTSYLGMKSVTE
QDFEWLSKNPKILEASVIICRVIDDTATYEVEKSRGQIATGIECCMRDYGITTKEAMTKF
QEMAEAAWKDLNEGLLRPTPVATEFLSRILNLARIVEVTYIHNLDGYTHPEKVLKPHINA
LLVDSIEI
NT seq 1647 nt   +upstreamnt  +downstreamnt
atggccgcagcagcagttggcaactatgaagaagagattgttcgccccgtcgccgacttc
tcccctagtctctggggtgatcagttcctttcattctccattaaaaatcaggttgcagaa
aagtatgctaaagagattgaagcattgaaggaacaaacgaggaatatgctgtcagcaact
ggaatgaaattggctgatacactgaatttgattgacattattgaacgtcttggcatctcc
taccactttgaaaaagaaattgatgagattttggatcaaatttataaccaaaactcaaac
tgcgacgatttgtgcatttctgcacttcaatttcgattgctcaggcaacatggtttcaac
atctctcctgaaattttcagcaaattccaagatgaaaatggcaaattcaaggagtctctt
gctagtgatgtcttaggattattaaacttgtatgaagcttcacatgtaaggactcatgct
gacgatatcttagaagacgcacttgctttctccactatccatcttgaatctgcagctcca
catttgaaatctccacttagggagcatgtgacacatgcccttgagcaatgtttgcacaaa
ggcgttcctagagtcgagacccgattcttcatctcatcaatctatgagaaggaacaatcg
aagaataatgtgttacttcgatttgccaaattggatttcaacttgctccagatgttgcac
aaacaagaacttgctcaagtatcaaggtggtggaaagatttggatttcgtaacaacacta
ccatatgctagagatcgagtagttgaatgttacttttgggcattaggagtttattttgag
cctcaatactctcaagcacgtgtcatgctcgttaagacaatatcgatgatttcgattgtc
gatgacacctttgatgcttacggtacagttaaagaacttgaggcatacacagatgccata
caaagatgggatatcaacgaaattgatcggcttcctgattacatgaaaatcagttataaa
gctattctagatctttacaaagattatgaaaaggaattgtctagtactggaagatctcat
attgtctgccatgcaatagaaagaatgaaagaagtagtaagaaattataatgtcgagtca
acatggtttattgaaggatatatgccacctgtttctgaatacctaagcaatgcactagca
actactacatattactaccttgcgacaacatcgtatttgggcatgaagtctgttacggag
caagattttgagtggttgtcaaagaatcctaaaattcttgaagctagtgtgataatatgc
cgagttattgatgacacagccacatacgaggttgagaaaagtaggggacaaattgcaaca
ggaattgagtgctgcatgagagattatggcataacaacaaaagaggcaatgactaaattt
caagaaatggctgaggcagcatggaaggatcttaatgaaggacttcttaggcccactcct
gtcgctacggagtttttatctcgtattctcaatcttgcccgtattgttgaggttacttat
atacacaatttagatggatacactcatccggagaaagtcttgaaacctcacatcaatgcc
ctacttgtggactccatcgaaatttga

DBGET integrated database retrieval system