KEGG   Oryza brachyantha (malo sina): 102716963
Entry
102716963         CDS       T02995                                 

Name
(RefSeq) cytochrome P450 93G1-like
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
obr  Oryza brachyantha (malo sina)
Pathway
obr00941  Flavonoid biosynthesis
obr01100  Metabolic pathways
obr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:obr00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    102716963
   00943 Isoflavonoid biosynthesis
    102716963
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:obr00199]
    102716963
Enzymes [BR:obr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     102716963
Cytochrome P450 [BR:obr00199]
 Cytochrome P450, plant type
  CYP93 family
   102716963
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 102716963
NCBI-ProteinID: XP_040378890
Position
4:complement(1982173..1984991)
AA seq 526 aa
MTSFMEAVQPPLFPTSTMGALALGLAAVVVIVLVHVAMNAFGRRGFPPSPASLPVIGHLH
LLRPPVHRTFHELAERLGPLMHVLLGSTHCVVASSADVAAELIRSHEAKILDRPLTVVTR
QFAYDSAGFVFAPYGPHWRFVKRLCMSELLGPRTVEQLRPVRRVGLVSLLGSVLHAAPRT
VDLTRELIRMSNTSIIRMAASTVPGTVTEEAHELVKVVAELIGAFNADDYIALCRGWDLQ
GLRRRAADVHRRFDALLEEIIKHKEEARAAKKKELEVDGAGGGGSGKDLLDILLDKAEDG
AAAVKLRRDNIKAIIIDVVTAGSDTSAAMVEWMLAELMNHSEALRKVRDEIDGVVGRDRI
AGEADLPSLPYLQAAYKETLRLRPAAPIAHRQSTEEIHIRGYRVPAQAAVFFNLWSIGRD
PAYWDAPLEFRPERFLAGGGSEGLEPRGQHFQFMPFGSGRRGCPGMGLALQSVPAVVAAL
VQCFDWECSTGWMEIDMEEGDGLVCARKHPLLLHAHPRLTPFPPLL
NT seq 1581 nt   +upstreamnt  +downstreamnt
atgacatcgttcatggaagcagtgcagccgccgctgtttccaacgagtacgatgggcgcc
ctggctctgggcctggccgccgtcgtcgtcatcgtgcttgtgcacgtcgccatgaacgcc
tttggccggcgcgggtttcccccgagcccggccagcctaccagtgatcgggcacctccac
ctgctccggccgccggtgcaccgcaccttccacgagctcgccgagcgtctcggccccctg
atgcacgtccttctcgggtcgacgcactgcgtggtggcgagctcggccgacgtggcggcg
gagctgattcgcagccacgaggcgaagatcctggaccggccgctgacggtggtgacccgg
cagttcgcgtacgactcggccggcttcgtgttcgcgccctacggcccgcactggcgcttc
gtgaagcggctgtgcatgtcggagcttctcggcccgcgcacggtggagcagctgcgtcct
gtgcgccgcgtcggtcttgtgtctctgcttggcagcgtgctccatgctgcgcccaggacg
gtggacctcacccgcgagctcatccgcatgtccaacacgtccatcatccgtatggccgcg
agcacggtgccgggcaccgtgacggaggaggcgcatgagctggtcaaggtggtggcggag
ctgatcggtgcctttaacgctgacgactacatcgccttgtgccgtgggtgggacctgcag
ggcctgcgaaggcgggccgccgacgtgcaccgccggttcgacgcgctgctggaggagatc
ataaagcacaaggaggaggcgagggcggcgaagaagaaggagctggaggtagacggagcc
ggaggaggcggcagtggaaaggacctgctggacatcctgctggacaaggcggaggacggc
gcggcggcggtgaagctccgcagagacaacatcaaggccatcatcatcgacgtggttact
gccggttccgacacttcggcagccatggtggagtggatgctggcggagctgatgaaccac
tcggaggccctgcgcaaggtgcgggacgagatcgacggcgtggtgggccgggacaggatc
gccggcgaggccgacctgcccagcctgccgtatctgcaggcagcgtacaaggagacgctg
cggctgcggccggcggcgcccatcgcgcaccggcagtccacggaggagatccacatccga
gggtacagggtgccggcgcaggcggcagtgttcttcaacttgtggtccatcgggcgcgac
ccggcctactgggacgcgccgctggagttcaggccggagaggttcctcgccggcggcggt
agcgagggcctggagccgcgcgggcagcacttccagttcatgccgttcgggagcgggagg
cgcggatgccccggcatggggctggcgctgcagtcggtgccggcagtagtggcggcgctc
gtgcagtgcttcgattgggaatgctcaacggggtggatggagatagacatggaggagggc
gacgggctggtgtgcgcgcggaagcatccgctgctgctccacgcccacccgcgcctcacc
cccttcccgccgctcctctag

DBGET integrated database retrieval system