Ochrobactrum sp. BTU1: KMS41_09950 Help Entry KMS41_09950       CDS       T09943                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism occ  Ochrobactrum sp. BTU1 Brite KEGG Orthology (KO) [BR:occ00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:occ03400]     KMS41_09950 (mutT) Enzymes [BR:occ01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      KMS41_09950 (mutT) DNA repair and recombination proteins [BR:occ03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     KMS41_09950 (mutT)  Prokaryotic type     KMS41_09950 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like NUDIX_2 DUF6480 Motif Other DBs NCBI-ProteinID:  QWK77397 Position 1:complement(2059010..2059426) Genome browser AA seq 138 aa AA seqDB search MSEIKSRRIILVAACALVDADGRVLLAQRPEGKSLAGLWEFPGGKVEVGETPEETLIREL QEEIGVTTKVACLAPLTFASHTYDDFHLLMPLYVCRRFEGVAQGLEGQALKWVRPKDMRD YPMPPADEPLIPFLIDLL NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgagcgagattaaatcccgccgtataatactggttgcagcctgtgcgctggttgatgct gatggtcgcgtgcttcttgcacagcgtccggagggtaaatcacttgcaggtctttgggag tttccgggcggtaaggtagaagttggtgaaacgcctgaagaaacgctgatccgagagctt caggaagaaatcggcgtgacgacaaaggttgcctgtctcgccccgctcacttttgccagc cacacctacgatgactttcatcttttgatgccgctctatgtctgtcgccgctttgaaggt gtggcacaggggctggaaggacaggcactgaaatgggtgcgcccaaaggatatgcgcgac tatccgatgccgccagctgatgagccgttgatcccgtttctaatcgatttgttgtga

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (5) Pfam (5) All databases (6) Download RDF

DBGET integrated database retrieval system