KEGG   Oceanimonas sp. GK1: GU3_14325
Entry
GU3_14325         CDS       T01667                                 
Name
(GenBank) P-hydroxybenzaldehyde dehydrogenase
  KO
K20199  4-hydroxybenzaldehyde dehydrogenase (NADP+) [EC:1.2.1.96]
Organism
oce  Oceanimonas sp. GK1
Pathway
oce00623  Toluene degradation
oce01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:oce00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00623 Toluene degradation
    GU3_14325
Enzymes [BR:oce01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.96  4-hydroxybenzaldehyde dehydrogenase (NADP+)
     GU3_14325
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-ProteinID: AEY02618
UniProt: H2FTZ1
Position
complement(3113215..3114684)
AA seq 489 aa
MTTAPYQNFELQLLAGQWRAGHSERKLQVQNPYSQETLLELNLATGEDLDESFHCAREAQ
KSWAAMAPAARAAIMLKAVEIFDQRKDEIVDWIIKESGSTRIKAQIEWGAARAITLEAAS
FPSRVHGRILPNDVPGKESRVYRKPLGVVGVISPWNFPLHLTQRSVAPALALGNAVVIKP
ASDTPVTGGLLIARIFEEAGLPAGVLNVVVGSGAEIGDAFVEHPVPAFISFTGSTEIGLN
IGRLASGGKHLKHVALELGGNSPFVVLADADLEQAVNAAVVGKFLHQGQICMAVNRIIVE
QPLAEAFTRRYVERVKALPYGDPSKAETVVGPVINQKQLQGLLQKIETANAEGATLLVGG
EPQGNVLPPHVFGDVTADMEIAREEIFGPLVGIQVARDEQHALELANQSEYGLSSAVFTG
SLERGVRFAQGIQAGMTHVNDMPVNDAPNAAFGGEKSSGLGRFNGEWAIEEFTTDHWITV
QYEPRRYPF
NT seq 1470 nt   +upstreamnt  +downstreamnt
atgactaccgccccctatcagaattttgagttacagctcctcgccggtcagtggcgggca
gggcattcggagcgcaagctgcaggtgcagaacccctattcccaggaaaccctgctggag
ctgaacctggccaccggagaggatcttgatgaatccttccattgcgctcgcgaggcccag
aaaagctgggccgccatggcaccggcggcgagagccgcgatcatgctgaaagcggtggag
atctttgatcagcgcaaggacgagattgtcgactggatcatcaaggagtcgggcagtacc
cgcatcaaggcccagatcgagtggggggccgcccgcgccattaccctggaagcggccagc
tttccctcccgtgtgcacggccgtattttgcccaacgacgttccgggcaaggaaagccgg
gtctaccgcaagccgctgggggtggtgggcgtgataagcccctggaatttcccgcttcac
ctgacccagcgttccgtggcgccggccctggccctggggaacgctgtggtgatcaaaccg
gccagtgataccccggtaaccggtggcctgctgattgcccgcatttttgaagaagccggc
ctgcctgccggtgtgctcaatgtggtggtgggctccggcgccgagattggcgacgctttt
gtcgagcatccggtaccggcctttatttcctttaccggctccaccgagattggcctgaac
atcggtcgcctggccagtggcggcaaacacctcaagcatgtggcgctggagctcggcggc
aacagcccctttgtggtgttggccgatgccgatctcgagcaggcggtcaacgccgccgtg
gtgggcaagttcctgcaccaggggcagatctgcatggcggtgaaccgcatcatcgtggag
cagcccctggccgaggcattcacccgtcgttatgtggagcgggtcaaggcactgccttac
ggtgatccgagcaaggccgagacggtggtgggcccggtgatcaaccagaagcagctgcag
gggctgttgcagaaaattgaaaccgccaacgcggagggagccactctgctggtggggggc
gagcctcagggcaatgtgctgccgccccatgtgtttggcgacgtgaccgccgacatggag
attgcccgggaagagatcttcggccccctggtgggtattcaggtggctcgcgacgaacag
cacgccctggaactggccaatcagagcgaatacggcctgtccagcgccgtctttaccggc
agcctggagcggggggtgcgcttcgctcagggtattcaggcgggcatgacccatgtcaat
gacatgccggtgaatgatgcgccgaatgcggcctttggcggcgagaaaagctcgggtctg
ggtcgctttaacggtgagtgggccattgaggagttcaccaccgaccactggatcaccgtg
cagtacgagccgcgtcggtatccgttctaa

DBGET integrated database retrieval system