Ochrobactrum sp. EEELCW01: GTN27_11190 Help Entry GTN27_11190       CDS       T07148                                  Symbol mutT Name (GenBank) 8-oxo-dGTP diphosphatase MutT   KO K03574   8-oxo-dGTP diphosphatase [EC:3.6.1.55] Organism ocl  Ochrobactrum sp. EEELCW01 Brite KEGG Orthology (KO) [BR:ocl00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:ocl03400]     GTN27_11190 (mutT) Enzymes [BR:ocl01000]  3. Hydrolases   3.6  Acting on acid anhydrides    3.6.1  In phosphorus-containing anhydrides     3.6.1.55  8-oxo-dGTP diphosphatase      GTN27_11190 (mutT) DNA repair and recombination proteins [BR:ocl03400]  Eukaryotic type   Other factors with a suspected DNA repair function    Modulation of nucleotide pools     GTN27_11190 (mutT)  Prokaryotic type     GTN27_11190 (mutT) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  NUDIX_4 NUDIX Nudt16-like DUF6480 NUDIX_2 YhfZ_C Motif Other DBs NCBI-ProteinID:  QTN03690 Position 1:complement(2344402..2344818) Genome browser AA seq 138 aa AA seqDB search MTEVKGRRILLVAACALVDSDGRVLLTQRPEGKQLAGLWEFPGGKVEPGETPEETLIREL QEEVGITTKAACLAPLTFASHTYDDFHLLMPLYVCRRYEGIARGLEGQALKWVRPKDMRD YPMPPADEPLIPFLLDLL NT seq 417 nt NT seq  +upstreamnt  +downstreamnt atgaccgaggtaaagggacgccgcattcttctggtagctgcttgcgcactggtggattcg gatggccgggttctgctgacgcagcgcccggaaggcaagcagctggccgggctgtgggag tttcccggtggcaaagtggaaccgggcgaaacgccggaagaaacgctgatccgcgaattg caggaagaagtcggcatcacgacgaaagcggcctgccttgcaccgctgacttttgcgagc catacctatgatgacttccacctgctgatgccgctctatgtctgccgccgttatgaaggt atcgcgcgggggctcgaagggcaggcgctgaaatgggttcgtccgaaggatatgcgcgac tatccgatgccgccagccgacgaaccgctgatcccgtttctgcttgatctgctgtag

All links   Gene (1) NCBI-PROTEINID (1) Protein domain (6) Pfam (6) All databases (7) Download RDF

DBGET integrated database retrieval system