KEGG   Oceanobacillus iheyensis: OB2843
Entry
OB2843            CDS       T00093                                 
Name
(GenBank) muconate cycloisomerase
  KO
K20022  galactarate dehydratase (D-threo-forming) [EC:4.2.1.158]
Organism
oih  Oceanobacillus iheyensis
Brite
KEGG Orthology (KO) [BR:oih00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    OB2843
Enzymes [BR:oih01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.158  galactarate dehydratase (D-threo-forming)
     OB2843
SSDB
Motif
Pfam: MR_MLE_C MR_MLE_N
Other DBs
NCBI-ProteinID: BAC14799
JAMSTEC: OB2843
UniProt: Q8EMJ9
Structure
Position
complement(2926661..2927836)
AA seq 391 aa
MKITDLELHAVGIPRHTGFVNKHVIVKIHTDEGLTGIGEMSDFSHLPLYSVDLHDLKQGL
LSILLGQNPFDLMKINKELTDNFPETMYYYEKGSFIRNGIDNALHDLCAKYLDISVSDFL
GGRVKEKIKVCYPIFRHRFSEEVESNLDVVRQKLEQGFDVFRLYVGKNLDADEEFLSRVK
EEFGSRVRIKSYDFSHLLNWKDAHRAIKRLTKYDLGLEMIESPAPRNDFDGLYQLRLKTD
YPISEHVWSFKQQQEMIKKDAIDIFNISPVFIGGLTSAKKAAYAAEVASKDVVLGTTQEL
SVGTAAMAHLGCSLTNINHTSDPTGPELYVGDVVKNRVTYKDGYLYAPDRSVKGLGIELD
ESLLAKYQVPDLSWDNVTVHQLQDRTADTKS
NT seq 1176 nt   +upstreamnt  +downstreamnt
atgaaaattacggatttggaattacatgcagtcggtattcctcgtcatacaggatttgtg
aataaacatgttattgttaaaattcatactgacgaaggtttaacagggatcggtgaaatg
tctgatttctcccacttacccctttattcggtggatcttcatgatttaaaacaaggactt
ttgtccattctattaggtcagaatccatttgatttgatgaaaattaataaggaattaacc
gataatttcccagaaacgatgtactattatgaaaaaggaagttttataagaaacgggata
gataatgcattacatgatttatgcgcaaagtatttagatatttctgtatcggattttcta
ggaggtagagtcaaagaaaaaataaaagtctgctatccgatttttagacatcgattctcg
gaggaagtagaaagcaatcttgatgtggtccgtcaaaaattggaacagggttttgatgtt
tttcgattatacgtagggaaaaaccttgatgcggatgaggagtttttatctagggtgaaa
gaagaatttggctctagggtacgtatcaaatcctatgattttagtcatctactaaactgg
aaagatgctcaccgggcaatcaagcgtctaaccaaatatgatttgggattagaaatgata
gaaagtccagcaccgaggaatgactttgatggtttgtatcaactaagactaaagacagac
tatccaatcagtgaacatgtgtggagttttaaacagcaacaagaaatgataaaaaaagat
gcgatcgacatctttaatatctccccggtatttattggcgggctcacatctgctaaaaaa
gcagcctatgcagcggaagtagcaagtaaagatgtggttctgggaacgacccaagaatta
tctgttgggacggcagccatggctcatctaggatgctctttaacaaatataaaccacact
tctgatcctactggtccagagctttatgtgggggatgtggtcaaaaatagagttacctat
aaagatgggtatctgtatgctccagaccggagtgtaaagggacttggtattgaacttgat
gaatcattattagcaaaatatcaagtacctgatttgagttgggataatgtgacagtgcat
caacttcaagaccgtacagctgatacaaaatcttaa

DBGET integrated database retrieval system