KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329722
Entry
4329722           CDS       T01015                                 

Name
(RefSeq) oryzalexin D synthase
  KO
K16084  ent-cassa-12,15-diene 11-hydroxylase / oryzalexin D synthase [EC:1.14.14.112 1.14.14.123]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4329722
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4329722
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.112  ent-cassa-12,15-diene 11-hydroxylase
     4329722
    1.14.14.123  oryzalexin D synthase
     4329722
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP76 family
   4329722
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4329722
NCBI-ProteinID: XP_015623630
UniProt: Q6YTF1
Position
2
AA seq 500 aa
MENSQMWLLWGALSVALFFYFSTLRRRYAGGKPLPPGPTPLPLIGNLHLVGGGTFHHKLR
DLARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVF
IPSSDPQWKALRGIHASHVFTPRVLAAVRPIRERKVGDLIAYLRAHAGEEVLVGHAMYTG
ILNMVSFSYFSVDIVDMGSQMARELREVVDDIILVVGKPNVSDFYPFLRPLDLQGLRRWT
TKRFNRVFSIMGDIIDRRLAHIRDNKPRHDDFLDSILELMAAGKIDRVNVLNMLFEAFVA
GADTMALTLEWVMAELLKNPSVMAKARAELRDVLGDKEIVEEADAARLPYLQAVLKEAMR
LHPVGALLLPHFAMEDGVEVGGYAVPKGSTVLFNAWAIMRDAAAWERPDEFVPERFVERT
PQLDFRGKDVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWELPGGMTAEELDVSE
KFKTANVLAVPLKAVPVLIK
NT seq 1503 nt   +upstreamnt  +downstreamnt
atggagaatagccagatgtggcttctgtggggagccctctccgtggcgctcttcttctac
ttctccaccctgcgacgacgctacgccggcggcaagcccctccccccgggcccgacgccg
ctgccgctcatcggcaacctacacttggtcggcggcggcacgttccaccacaagctcagg
gacctggcacgcgtccacggccccgtcatgacgctcaagctcggactcgccaccaacgtg
gtcatctcctcccgggaggccgccatcgaggcgtacaccaagtacgaccgccacctcgcc
gcgcgcgccaccccggacaccttccgcgcctgcggcttcgccgaccgctccatggtgttc
atcccgagctccgacccgcagtggaaggccctgcgggggatccacgcctcgcacgtcttc
accccgcgggtgctcgccgcggtgcgccccatccgcgagaggaaggtgggcgacctcatc
gcctacctccgcgcgcacgccggggaggaggtgctcgtcggccacgccatgtacacgggc
atcctcaacatggtgtccttctcctacttctccgtcgacatcgtcgacatgggctcgcag
atggcccgcgagctgcgggaggtggtggacgacatcatcttggtggtcgggaagcccaac
gtgtccgacttctacccgttcctccggccgctggacctgcagggcctgcgccgctggacg
acgaagcggttcaacagggtgttctccatcatgggcgacatcatcgaccgccgtttggct
cacatccgcgacaacaagccgaggcacgacgacttcctcgactcaatcctcgagctcatg
gctgccggcaagatcgatcgtgtcaacgtgctcaacatgttgttcgaggctttcgttgcc
ggggctgacaccatggctcttaccttggagtgggtaatggccgagctgctcaaaaacccg
agcgtgatggccaaggcgcgcgccgagctgagggatgtgctcggcgacaaggagatcgtg
gaggaggccgacgcggcgaggctgccctacctgcaggccgtgctgaaggaggccatgaga
ctgcacccggtgggcgcgctgctgctgccgcacttcgccatggaggacggcgtggaggtc
ggcggctacgcggtgcccaagggctccacggtgctcttcaacgcgtgggcgatcatgcgc
gacgcggcggcgtgggagaggcccgacgagttcgtgccggagcggttcgtggagaggacg
ccgcagctggacttcagagggaaggacgtggagttcatgccgttcgggtccgggaggcgg
ctgtgccctgggctgccgttggccgagcgtgtcgtgccgttcattctggcgtcgatgctg
cacacgttcgagtgggagctccccggcggcatgacggcggaggagttggacgtgtccgag
aagttcaagactgccaatgtccttgctgtgcctctcaaggctgtgcctgtcctgatcaaa
tag

DBGET integrated database retrieval system