KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4329723
Entry
4329723           CDS       T01015                                 

Definition
(RefSeq) ent-cassadiene C11-alpha-hydroxylase 1-like
  KO
K16084  ent-cassa-12,15-diene 11-hydroxylase / oryzalexin D synthase [EC:1.14.14.112 1.14.14.123]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00904  Diterpenoid biosynthesis
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00904 Diterpenoid biosynthesis
    4329723
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4329723
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.112  ent-cassa-12,15-diene 11-hydroxylase
     4329723
    1.14.14.123  oryzalexin D synthase
     4329723
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP76 family
   4329723
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 4329723
NCBI-ProteinID: XP_015623593
UniProt: Q6YTE2 Q6YV99
Position
2
AA seq 499 aa
MENSQVWLLWGALSVAVLFYLSTLRRRYAGGKPLPPGPTPLPLIGNLHLAGGTFHHKLRD
LARVHGPVMTLKLGLATNVVISSREAAIEAYTKYDRHLAARATPDTFRACGFADRSMVFI
PSSDPQWKALRGIQGSHVFTPRGLAAVRPIRERKVGDLIAYLRAHAGEEVLLGQAMYTGL
LNLVSFSYFSIDIVDMGSQMARDLREVVDDIISVVGKPNISDFYPFLRPLDLQGLRRWTT
KRFNRVFSIMGDIIDRRLAHIRDGKPRHDDFLDSLLELMATGKMERVNVVNMLFEAFVAG
VDTMALTLEWVMAELLHNPAIMARVRAELSDVLGGKEAVEEADAARLPYLQAVLKEAMRL
HPVGALLLPHFAAEDGVEIGGYAVPRGSTVLFNAWAIMRDPAAWERPDEFVPERFLGRSP
PLDFRGKDVEFMPFGSGRRLCPGLPLAERVVPFILASMLHTFEWKLPGGMTAEDVDVSEK
FKSANVLAVPLKAVPVLIK
NT seq 1500 nt   +upstreamnt  +downstreamnt
atggagaatagccaggtgtggctgctatggggagctctctccgtcgctgtcctcttctac
ctctccaccctgcgacgacgctacgccggcggcaaacccctccccccgggcccgacgcca
ctgccgctcatcggcaacctccacctggccggcggcacgttccaccacaagctcagggac
ctggcgcgcgtccacggccccgtgatgacgctcaagctcggcctcgccaccaacgtggtc
atctcctcccgggaggccgccatcgaggcgtacaccaagtacgaccgccacctcgccgcg
cgcgccactccggacaccttccgcgcgtgcggcttcgccgaccgctccatggtgttcatc
ccgagctccgacccgcagtggaaggccctgcgcgggatccagggctcccacgtcttcacc
ccgcgtggccttgccgccgtgcgccccatccgtgagcggaaggtgggcgacctcatcgcc
tacctccgcgcgcacgccggcgaggaggtgctcctcggccaggccatgtacactggcctc
ctcaacctcgtgtccttctcctacttctccatcgacatcgtcgacatgggctcgcagatg
gcccgcgacctgcgggaggtggtggacgacatcatctcggtggtcgggaagcccaacatc
tccgacttctacccgttcctccggccgctggacctgcagggcctgcgccgctggacgacg
aagcggttcaacagggtgttctccatcatgggcgacatcatcgaccgccgcctggctcac
atccgcgacggcaagccgaggcacgacgacttcctcgactcgctcctcgagctcatggcc
accggcaagatggagcgtgtcaacgtggtgaacatgctgttcgaggccttcgtcgccggc
gtggacaccatggccctcaccctggagtgggtgatggccgagctgctccacaacccggcc
atcatggcgagggtgcgcgcggagctgagcgacgtgctcggcgggaaggaggccgtggag
gaggccgacgcggcgaggctgccctacctccaggccgtgctgaaggaggccatgaggctg
cacccggtgggcgcgctgctgctgccgcacttcgccgcggaggacggcgtggagatcggc
ggctacgcggtgccgaggggctccacggtgctcttcaacgcgtgggcgatcatgcgcgac
ccggcggcgtgggagaggcccgacgagttcgtgccggagcgcttcctggggaggtcaccc
ccgctggacttcagggggaaggacgtggagttcatgccgttcgggtccgggaggcggctg
tgccccgggctgccgctggcggagcgcgtcgtgccgttcatcctggcgtcgatgctgcac
acgttcgagtggaagctccccggcggcatgacggcggaggacgtggacgtgtccgagaag
ttcaagtctgccaatgtgcttgccgtgcctctcaaggccgtgcctgtcctgatcaaatag

DBGET integrated database retrieval system