KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 4334886
Entry
4334886           CDS       T01015                                 

Name
(RefSeq) cytochrome P450 93A2
  KO
K23180  flavone synthase II [EC:1.14.19.76]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00941  Flavonoid biosynthesis
osa01100  Metabolic pathways
osa01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    4334886
   00943 Isoflavonoid biosynthesis
    4334886
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:osa00199]
    4334886
Enzymes [BR:osa01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.76  flavone synthase II
     4334886
Cytochrome P450 [BR:osa00199]
 Cytochrome P450, plant type
  CYP93 family
   4334886
SSDB
Motif
Pfam: p450 DUF6237
Other DBs
NCBI-GeneID: 4334886
NCBI-ProteinID: XP_015636893
UniProt: Q0JFI2
Position
4:complement(99772..101714)
AA seq 516 aa
MASLMEVQVPLLGMGTTMGALALALVVVVVVHVAVNAFGRRRLPPSPASLPVIGHLHLLR
PPVHRTFHELAARLGPLMHVRLGSTHCVVASSAEVAAELIRSHEAKISERPLTAVARQFA
YESAGFAFAPYSPHWRFMKRLCMSELLGPRTVEQLRPVRRAGLVSLLRHVLSQPEAEAVD
LTRELIRMSNTSIIRMAASTVPSSVTEEAQELVKVVAELVGAFNADDYIALCRGWDLQGL
GRRAADVHKRFDALLEEMIRHKEEARMRKKTDTDVGSKDLLDILLDKAEDGAAEVKLTRD
NIKAFIIDVVTAGSDTSAAMVEWMVAELMNHPEALRKVREEIEAVVGRDRIAGEGDLPRL
PYLQAAYKETLRLRPAAPIAHRQSTEEIQIRGFRVPAQTAVFINVWAIGRDPAYWEEPLE
FRPERFLAGGGGEGVEPRGQHFQFMPFGSGRRGCPGMGLALQSVPAVVAALLQCFDWQCM
DNKLIDMEEADGLVCARKHRLLLHAHPRLHPFPPLL
NT seq 1551 nt   +upstreamnt  +downstreamnt
atggcatcgttgatggaagtgcaggtgccgctgttgggaatgggcactacgatgggcgcc
ctggctctggctctcgtcgtcgttgtggttgtgcacgttgccgtgaacgcctttgggcgg
cggcggcttcccccgagtccggcgagcctaccggtgatcgggcaccttcacctgctccgg
ccgccggtgcaccgcaccttccacgagctggcggcgaggctgggccccctgatgcacgtc
cggctggggtcgacgcactgcgttgtggcgagctcggcggaggtggcggcggagctgatc
cgcagccacgaggcgaagatatcggagcggccgctgacggcggtggcccggcagttcgcg
tacgagtcggcggggttcgcgttcgcgccctacagcccgcactggcgcttcatgaagcgg
ctgtgcatgtcggagctgctgggcccgcgcacggtggagcagctgcgccccgtgcgccga
gccgggctggtgtcgctgctgcgccacgtgttgtcgcagccggaggcggaggcggtggac
ctgacccgcgagctcatccgcatgtccaacacctccatcatccgcatggccgccagcacg
gtccccagcagcgtgacggaggaggcgcaggagctggtgaaggtggtggcggagctggtg
ggcgccttcaacgccgacgactacatcgccctgtgccgtggctgggacctgcagggcctc
gggcgccgtgcggccgacgtgcacaagaggttcgacgcgctgctggaggagatgatcagg
cacaaggaggaggctaggatgcggaagaagacagacacagacgtcggcagcaaggacctg
cttgacatcctgctggacaaggcggaggacggcgcggcggaggtgaagctcaccagagac
aacatcaaggccttcatcatcgacgttgttactgccgggtccgacacttcggccgccatg
gtggagtggatggtggcggagctgatgaaccacccggaggccctgcgcaaggtgcgggag
gagatcgaggcggtggtggggcgggacaggatcgccggcgagggggacctgccgagactg
ccgtatctgcaggcggcgtacaaggagacgctgcggttgaggccggcggcgccgatcgcg
cacaggcagtcgacggaggagatccagatccgagggttcagggtgccggcgcagacggcg
gtgttcatcaacgtgtgggccatcgggcgagacccggcgtactgggaggagccgctggag
ttcaggccggagcggttcctcgccggcggcggcggcgagggcgtggagccgcgcgggcag
cacttccagttcatgccgttcgggagcggccggcgcgggtgccccgggatggggcttgcg
ctgcagtcggtgccggcggtggtggcggcgctgctgcagtgcttcgattggcagtgcatg
gacaataagttgatagacatggaggaggcagacggcctggtttgcgctcggaagcatcgc
ctcctcctccacgcccacccgcgcctccaccctttcccgccgctcctctag

DBGET integrated database retrieval system