KEGG   Oryza sativa japonica (Japanese rice) (RefSeq): 9268610
Entry
9268610           CDS       T01015                                 

Name
(RefSeq) parkeol synthase isoform X1
  KO
K19010  parkeol synthase [EC:5.4.99.47]
Organism
osa  Oryza sativa japonica (Japanese rice) (RefSeq)
Pathway
osa00909  Sesquiterpenoid and triterpenoid biosynthesis
Brite
KEGG Orthology (KO) [BR:osa00001]
 09100 Metabolism
  09109 Metabolism of terpenoids and polyketides
   00909 Sesquiterpenoid and triterpenoid biosynthesis
    9268610
Enzymes [BR:osa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.47  parkeol synthase
     9268610
SSDB
Motif
Pfam: SQHop_cyclase_C SQHop_cyclase_N Prenyltrans TED_complement Pec_lyase Mago-bind
Other DBs
NCBI-GeneID: 9268610
NCBI-ProteinID: XP_015617632
UniProt: H2KWF1
Position
11:4521742..4557912
AA seq 759 aa
MWRLKVSEGGSPWLRSVNNLLGRQVWEFDPDLGTPEERADVEKARREFAEHRFERKHSSD
LLMRMQFAKENCQKLDLLAVKRGEHEDVMGEAVWSSLKRAISRVCNLQAHDGHWPGDYAG
LMFFLPGLIITLHVSGVLNTVLSSEHQKEMRRYIYNHQNEDGGWGLHIEGHSTMLGSSLN
YVALRLLGEGPNGGDGCIENGRNWILDHGGATFTTSWGKFWLSVLGVFDWSGNNPVPPEL
LLLPYQLPFHPGRMSSYIRMVFIPMSYIYGKRFVGPVTPVVLELRSELYNDPYDEIDWNK
ARTQCAKEDMYYPRSSKLDMFWSFLHKFIEPVLLRWPGRKLREKALATSMRNVHYEDECT
RYICFGGVPKALNILACWIEDPSSEAFKCHIARVYDYLWIAEDGMKMQIYDGSQVWDAGL
TVEALVATDLVKELGPTLKRAHSFLKNSQLLDNCPRDFNRWYRHISKGGWTFTTADDGWQ
VSDCTATALKACLLLSRISPEIVGEPLEIDAQYDAVNCLMSLMNDNGGFSAFELVRSNTW
LEHINPTEAFGRVMIEYPYVECTSSSIQCLALFKKLHPGHRKEEVENCISKGANFIESSQ
RSDGSWYGSWGICFTYATWFAVTGLVSAGRTLGNSATVRKACDFLLSKQLPSGGWGESYL
SCHDEVYTNLKGNRPHGTHTAWAMIALIDAGQAERDPVPLHRAAKALLNLQLEDGEFPQQ
EIVGVFLQTAMISYSQYRNIFPIMALTGYRRRVLLAGNI
NT seq 2280 nt   +upstreamnt  +downstreamnt
atgtggaggctgaaggtgtcggagggcggcagcccatggctgcggtcggtaaacaatctc
ctcggccggcaagtgtgggagttcgaccctgacctcggcacgccagaggagcgcgccgat
gtggagaaggcgcgccgcgagttcgccgagcaccgcttcgagcgcaagcattctagcgac
ctcctcatgcggatgcagttcgctaaagaaaactgtcaaaagctggaccttctcgctgtc
aagcgtggagagcacgaagacgtcatgggggaagctgtgtggagctctttgaaacgggcc
ataagccgcgtttgtaatttgcaggcacatgatggacactggcccggggattatgcagga
cttatgttctttttgcctggcttgattataacattgcatgtcagtggagttctgaacact
gttttatcatcggaacatcagaaggagatgcgccggtacatctataatcaccagaatgaa
gatggagggtgggggttgcacattgagggccacagcaccatgcttggctcatccctgaac
tatgttgctttgagattgcttggggagggtccaaatggtggagatggatgcatagagaat
ggtcgaaactggattttagatcatggaggagccacatttacgacatcatgggggaagttc
tggctctcggtacttggagtatttgattggtccggtaataacccagtgccaccagagtta
ttactattgccgtatcaactgccgtttcacccaggtcgaatgtcgagctatatccgaatg
gtgtttatacccatgtcttacatttatggaaaaaggtttgttggcccagtaacaccagtt
gtgctagagctaagaagtgaactatacaatgacccctatgatgagattgactggaacaaa
gctcgtactcagtgtgcaaaggaagatatgtactatccacgttcatccaaactggatatg
ttttggtcctttctccacaagtttattgaaccagttttgttgcgctggcctgggagaaaa
ctgagggagaaagctctggccacttccatgaggaatgttcactatgaagatgagtgcact
cgatacatctgtttcggtggtgtacccaaggcattaaatatccttgcttgctggattgaa
gatccaagctcagaggcattcaaatgccatattgcacgcgtatatgattatttatggatc
gctgaagacggcatgaagatgcagatttacgatggcagccaggtgtgggacgcaggtttg
acagttgaggcccttgtggctactgaccttgtcaaagagcttggaccaactcttaaacga
gcgcattccttccttaagaattcgcagttgcttgacaattgcccccgagatttcaaccgc
tggtatcgccatatatccaaaggtggatggacatttacaacagctgatgatggctggcaa
gtttcagattgcacggcgacagcactgaaggcatgtctattgttatcaaggatatctcct
gaaatcgttggtgaaccactggaaattgatgcacaatacgatgctgttaattgtctgatg
tctttgatgaatgataatggtggcttttcagcatttgaactcgtaaggtctaatacatgg
ctggagcatattaatcctacagaggcatttgggcgtgtaatgattgaatatccgtatgtc
gaatgtacatcatcatcaattcagtgtctagcattattcaaaaaacttcacccagggcac
cgcaaggaagaggtggaaaattgtatcagcaaaggtgctaatttcattgagagttctcag
agaagcgatggttcatggtatggttcttgggggatttgtttcacctatgccacatggttt
gcagtgacaggattagtttctgcaggcaggacacttgggaatagcgctacagttagaaag
gcatgtgactttctcttgtcaaaacagcttccttcgggtggctggggcgagagctatttg
tcatgtcatgacgaggtttacacaaatcttaaaggcaaccgacctcacggtacgcacact
gcgtgggccatgattgcactaattgatgcagggcaggctgaaagagatccagtgcctctg
catcgagcagccaaggctttgctcaacttgcaattagaggatggagaatttccacagcaa
gaaattgttggagtctttctccaaactgccatgatcagttattcccagtacaggaacatc
ttccctataatggctctcacagggtatcgccgccgagtactgcttgcaggcaacatatag

DBGET integrated database retrieval system