Ottowia testudinis: J1M35_15685 Help Entry J1M35_15685       CDS       T08188                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism otd  Ottowia testudinis Pathway otd02024   Quorum sensing otd03018   RNA degradation Brite KEGG Orthology (KO) [BR:otd00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     J1M35_15685 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     J1M35_15685 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:otd03019]     J1M35_15685 (hfq)    03036 Chromosome and associated proteins [BR:otd03036]     J1M35_15685 (hfq) Messenger RNA biogenesis [BR:otd03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      J1M35_15685 (hfq) Chromosome and associated proteins [BR:otd03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     J1M35_15685 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  QTD44522 UniProt:  A0A975H528 Position complement(3317415..3317669) Genome browser AA seq 84 aa AA seqDB search MSNKGQLLQDPFLNTLRREHIPVSIYLVNGIKLQGQIESFDQYVVLLRNTVTQMVYKHAI STIVPGRAVNFSSGGADPQDSEEK NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgagcaacaaagggcaactcctacaagacccgttcctgaacaccctgcgccgcgagcac attccggtgtccatttatttggtcaacggcatcaagctgcaaggtcagatcgaatcgttt gaccaatacgtcgtgttgctgcgcaacacggtgacgcaaatggtctacaagcatgccatc tcgaccatcgtgccggggcgtgccgttaacttctcgagtggcggcgccgatcctcaggac tctgaagaaaaataa

All links   Gene (1) NCBI-PROTEINID (1) Protein sequence (1) UniProt (1) Protein domain (3) Pfam (3) All databases (5) Download RDF

DBGET integrated database retrieval system