KEGG   Oligella ureolytica: I6G29_01440
Entry
I6G29_01440       CDS       T07321                                 
Name
(GenBank) N-acetyl sugar amidotransferase
  KO
K24326  aminotransferase
Organism
oue  Oligella ureolytica
Pathway
oue00541  O-Antigen nucleotide sugar biosynthesis
oue01100  Metabolic pathways
oue01250  Biosynthesis of nucleotide sugars
Brite
KEGG Orthology (KO) [BR:oue00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00541 O-Antigen nucleotide sugar biosynthesis
    I6G29_01440
SSDB
Motif
Pfam: FAM210A-B_dom ATP_bind_3 QueC NAD_synthase Asn_synthase PAPS_reduct FluMu_N
Other DBs
NCBI-ProteinID: QPT41278
Position
complement(256592..257662)
AA seq 356 aa
MDTTDPEITFDAQGVCNHCHEFDQVTAKRWFPNEEGKRKLDVLVAQLKKEGEGKAYDCIL
GLSGGLDSSFLALVMKDYGLRPLVVHVDAGWNSEDAVKNINTVVDYCGFKLHTKVVDWEE
VKDLQLAYLKAGVANQDVVQDHAFFANLYHFAVDNDIRYVINGGNIATESTFPSAWHHAA
MDEISLKAIHKKYGKVALKDYQTISFFEYYVYFPFVKKMTAVRPLNLMPYSQEIAQQRLE
SIGYISYERKHGESRFTKFFQNYYLPKKFNMDKRKITREQAVEKLNEPLYDHAELAEDKA
FIAEKLSITVSELDKYIEEPGRHYTDFPNWDSRYALLKKVQGIVAKLTGKNLNAYS
NT seq 1071 nt   +upstreamnt  +downstreamnt
atggacaccaccgaccctgaaattaccttcgatgctcaaggtgtgtgtaaccactgccat
gagtttgaccaagtgactgctaagcgttggtttccaaatgaagaaggtaaacgtaagtta
gacgttttagtcgcacagcttaaaaaagaaggtgagggcaaagcatacgactgtatttta
gggctcagcggtgggttagacagctctttcctcgccctagtcatgaaagactacggttta
aggcccttagtggtgcatgtggatgccggttggaacagtgaagatgccgtcaaaaacatt
aacactgtggttgattattgtggctttaagttgcacaccaaggtggttgattgggaagaa
gtaaaagacttacaacttgcttatttaaaagcaggcgtggcaaaccaagatgtggtgcaa
gaccatgcgttttttgccaatctgtatcactttgcggtagacaacgatattcgctatgtc
atcaacggtggcaacatagcaactgaatcaaccttcccgtcagcgtggcaccatgccgct
atggatgaaattagcctaaaagcgattcataagaaatacggtaaagtggctttaaaagat
taccaaaccatcagtttttttgagtattacgtttacttcccttttgtgaagaaaatgacc
gctgtaaggccgctaaatcttatgccctatagtcaagaaattgcgcagcaacgtttagaa
agcattggttatatatcctacgaacgtaagcatggtgagtcgcgctttaccaagtttttc
cagaattactacttacctaaaaaattcaatatggataaacgcaaaatcactcgtgaacag
gcagtagaaaagctaaacgaacccctctacgaccatgcagagctagcagaagacaaagcc
tttatagccgaaaaactaagtatcactgtttcagaactagataaatacattgaagaacct
ggcaggcactacaccgacttccccaactgggatagccgctacgcgctactgaaaaaagtg
caggggattgtggctaaattaacaggaaagaatctgaatgcttattcgtaa

DBGET integrated database retrieval system